Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015K356

Protein Details
Accession A0A015K356   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
92-114GSYKVYLYKKKKKINNKETIKIDHydrophilic
NLS Segment(s)
PositionSequence
101-105KKKKI
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002625  Smr_dom  
IPR036063  Smr_dom_sf  
Pfam View protein in Pfam  
PF01713  Smr  
PROSITE View protein in PROSITE  
PS50828  SMR  
Amino Acid Sequences MDVIIKINKKTGKKYIPCYDLHGYTKKEAYIEVKEVILECFKLKINSINFVTGRGNHPNVNGERGVLFKKFKEWLEDDEIINLVKNYVVGDGSYKVYLYKKKKKINNKETIKIDIKNGSIKRKNILVLKEEPIFDKNETNKRLIQIKEEIDKLLNRKESNLSLTNRKEELNLPLKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.74
3 0.73
4 0.69
5 0.69
6 0.64
7 0.6
8 0.57
9 0.54
10 0.47
11 0.45
12 0.46
13 0.39
14 0.34
15 0.3
16 0.3
17 0.28
18 0.28
19 0.26
20 0.23
21 0.23
22 0.23
23 0.21
24 0.17
25 0.13
26 0.1
27 0.11
28 0.12
29 0.13
30 0.14
31 0.19
32 0.21
33 0.26
34 0.27
35 0.3
36 0.28
37 0.3
38 0.3
39 0.25
40 0.27
41 0.26
42 0.27
43 0.23
44 0.24
45 0.28
46 0.27
47 0.28
48 0.24
49 0.19
50 0.18
51 0.18
52 0.19
53 0.16
54 0.16
55 0.13
56 0.17
57 0.2
58 0.2
59 0.24
60 0.24
61 0.26
62 0.31
63 0.32
64 0.29
65 0.26
66 0.25
67 0.2
68 0.17
69 0.13
70 0.06
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.05
78 0.06
79 0.07
80 0.07
81 0.07
82 0.08
83 0.11
84 0.19
85 0.28
86 0.37
87 0.45
88 0.54
89 0.62
90 0.72
91 0.8
92 0.83
93 0.84
94 0.82
95 0.81
96 0.76
97 0.75
98 0.68
99 0.58
100 0.5
101 0.43
102 0.36
103 0.36
104 0.36
105 0.39
106 0.41
107 0.41
108 0.41
109 0.41
110 0.44
111 0.42
112 0.42
113 0.38
114 0.36
115 0.38
116 0.38
117 0.35
118 0.32
119 0.28
120 0.27
121 0.23
122 0.25
123 0.28
124 0.35
125 0.37
126 0.39
127 0.4
128 0.42
129 0.48
130 0.43
131 0.41
132 0.39
133 0.42
134 0.44
135 0.42
136 0.39
137 0.35
138 0.37
139 0.36
140 0.36
141 0.37
142 0.33
143 0.35
144 0.39
145 0.39
146 0.42
147 0.45
148 0.43
149 0.46
150 0.5
151 0.53
152 0.49
153 0.46
154 0.43
155 0.39
156 0.43