Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015K3V8

Protein Details
Accession A0A015K3V8    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKITNKPSKKLRNLWKRVNYNKYQLHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, mito_nucl 13.5, mito 6.5
Family & Domain DBs
Amino Acid Sequences MKITNKPSKKLRNLWKRVNYNKYQLHVTISSVDSITKSEEIDDKVVYMNDLEKRKEAYGICGECNEPGTGEEWCQPCNAERFKENFKNWTSGNNDIDELIQYSQLNYKMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.89
4 0.89
5 0.88
6 0.83
7 0.82
8 0.78
9 0.7
10 0.63
11 0.54
12 0.48
13 0.4
14 0.35
15 0.28
16 0.23
17 0.2
18 0.17
19 0.16
20 0.12
21 0.11
22 0.12
23 0.09
24 0.09
25 0.09
26 0.11
27 0.13
28 0.14
29 0.13
30 0.11
31 0.12
32 0.12
33 0.1
34 0.08
35 0.1
36 0.14
37 0.16
38 0.17
39 0.17
40 0.19
41 0.19
42 0.22
43 0.19
44 0.18
45 0.22
46 0.22
47 0.22
48 0.21
49 0.21
50 0.18
51 0.19
52 0.14
53 0.08
54 0.07
55 0.08
56 0.08
57 0.09
58 0.13
59 0.13
60 0.14
61 0.14
62 0.14
63 0.15
64 0.22
65 0.25
66 0.23
67 0.27
68 0.32
69 0.41
70 0.49
71 0.5
72 0.5
73 0.49
74 0.5
75 0.46
76 0.48
77 0.44
78 0.42
79 0.41
80 0.36
81 0.34
82 0.29
83 0.29
84 0.23
85 0.2
86 0.14
87 0.13
88 0.11
89 0.12
90 0.16