Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015JVW8

Protein Details
Accession A0A015JVW8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
22-41TIDGRTKRNKWKIPASLNNEHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, pero 2, E.R. 2, cyto 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR025187  DUF4112  
Pfam View protein in Pfam  
PF13430  DUF4112  
Amino Acid Sequences MGWLFNFNRSQQDDDDIPPFITIDGRTKRNKWKIPASLNNEEKKFLIGVKKRAFKLDESCCCGCCVGLDPLVGFLPVIGDFAGIGLSFWLVNHMKNSNLVENHKIPIMLREMTIMIIKDAIVGFVPIIGDIIDCFYKANTYNSLVFQRYLVNQAKLRSVVKDNHKVEVITHNSDNLTNDNHDNRKKMLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.29
4 0.26
5 0.22
6 0.2
7 0.15
8 0.14
9 0.13
10 0.19
11 0.24
12 0.31
13 0.37
14 0.43
15 0.54
16 0.62
17 0.68
18 0.68
19 0.72
20 0.75
21 0.79
22 0.82
23 0.8
24 0.79
25 0.79
26 0.77
27 0.68
28 0.6
29 0.5
30 0.41
31 0.33
32 0.27
33 0.28
34 0.28
35 0.37
36 0.44
37 0.5
38 0.5
39 0.54
40 0.53
41 0.48
42 0.5
43 0.5
44 0.48
45 0.48
46 0.47
47 0.43
48 0.42
49 0.37
50 0.29
51 0.19
52 0.16
53 0.12
54 0.13
55 0.12
56 0.11
57 0.12
58 0.12
59 0.11
60 0.08
61 0.05
62 0.04
63 0.04
64 0.04
65 0.03
66 0.03
67 0.03
68 0.03
69 0.04
70 0.03
71 0.03
72 0.02
73 0.02
74 0.03
75 0.03
76 0.06
77 0.06
78 0.07
79 0.09
80 0.1
81 0.1
82 0.12
83 0.14
84 0.14
85 0.16
86 0.17
87 0.19
88 0.2
89 0.2
90 0.19
91 0.18
92 0.14
93 0.15
94 0.16
95 0.12
96 0.11
97 0.11
98 0.11
99 0.11
100 0.12
101 0.1
102 0.07
103 0.06
104 0.06
105 0.06
106 0.06
107 0.05
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.03
114 0.04
115 0.03
116 0.03
117 0.03
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.07
124 0.09
125 0.12
126 0.13
127 0.17
128 0.19
129 0.22
130 0.26
131 0.25
132 0.24
133 0.22
134 0.22
135 0.2
136 0.25
137 0.27
138 0.28
139 0.3
140 0.31
141 0.34
142 0.35
143 0.35
144 0.32
145 0.33
146 0.36
147 0.42
148 0.51
149 0.49
150 0.5
151 0.5
152 0.46
153 0.43
154 0.44
155 0.4
156 0.35
157 0.34
158 0.32
159 0.31
160 0.32
161 0.32
162 0.25
163 0.23
164 0.21
165 0.26
166 0.32
167 0.4
168 0.44
169 0.45