Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015K274

Protein Details
Accession A0A015K274    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
45-75DEDYTFKKRKNYKYKRIKIVKKYYKNCTFNKHydrophilic
NLS Segment(s)
PositionSequence
52-62KRKNYKYKRIK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSDSNSNFDVENELQGNSVLGFCTAKEIMQKDNYLQSNRNSAELDEDYTFKKRKNYKYKRIKIVKKYYKNCTFNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.1
5 0.09
6 0.06
7 0.06
8 0.06
9 0.05
10 0.09
11 0.09
12 0.09
13 0.12
14 0.14
15 0.17
16 0.19
17 0.2
18 0.18
19 0.24
20 0.27
21 0.26
22 0.27
23 0.25
24 0.29
25 0.29
26 0.29
27 0.23
28 0.2
29 0.22
30 0.19
31 0.2
32 0.14
33 0.15
34 0.15
35 0.2
36 0.22
37 0.2
38 0.28
39 0.34
40 0.44
41 0.54
42 0.64
43 0.7
44 0.8
45 0.88
46 0.9
47 0.93
48 0.92
49 0.92
50 0.92
51 0.92
52 0.91
53 0.9
54 0.9
55 0.9