Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015N6J6

Protein Details
Accession A0A015N6J6    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
68-88LVKVCRFRRRNRKLVGHLKKABasic
NLS Segment(s)
PositionSequence
75-86RRRNRKLVGHLK
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045379  Crinkler_N  
Gene Ontology GO:0005576  C:extracellular region  
Pfam View protein in Pfam  
PF20147  Crinkler  
Amino Acid Sequences MLSPSLRAQLGLRLGMRSWGRRAYRTAEILSPSLRAQLVLRLGMRSWGRRAYRTAEMLSPSLRARNLLVKVCRFRRRNRKLVGHLKKAIKMEKQIDFADVDADKLRLWKVEIPDDHDDQLRSLSLQNKDEVLATKKISKYFPVTPINVAQRGDQVTTSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.31
4 0.29
5 0.3
6 0.35
7 0.37
8 0.39
9 0.43
10 0.43
11 0.45
12 0.45
13 0.43
14 0.38
15 0.37
16 0.36
17 0.32
18 0.28
19 0.21
20 0.2
21 0.17
22 0.14
23 0.12
24 0.15
25 0.16
26 0.17
27 0.17
28 0.16
29 0.16
30 0.21
31 0.23
32 0.21
33 0.24
34 0.29
35 0.32
36 0.35
37 0.39
38 0.39
39 0.42
40 0.42
41 0.39
42 0.33
43 0.31
44 0.29
45 0.25
46 0.22
47 0.17
48 0.16
49 0.15
50 0.13
51 0.12
52 0.17
53 0.2
54 0.24
55 0.27
56 0.3
57 0.37
58 0.44
59 0.51
60 0.5
61 0.56
62 0.62
63 0.68
64 0.72
65 0.74
66 0.75
67 0.76
68 0.82
69 0.81
70 0.77
71 0.75
72 0.69
73 0.64
74 0.59
75 0.54
76 0.46
77 0.42
78 0.4
79 0.37
80 0.38
81 0.34
82 0.32
83 0.27
84 0.24
85 0.21
86 0.15
87 0.12
88 0.09
89 0.09
90 0.08
91 0.09
92 0.1
93 0.08
94 0.1
95 0.13
96 0.15
97 0.23
98 0.24
99 0.29
100 0.33
101 0.34
102 0.34
103 0.32
104 0.29
105 0.22
106 0.22
107 0.16
108 0.12
109 0.14
110 0.19
111 0.22
112 0.24
113 0.24
114 0.24
115 0.24
116 0.25
117 0.26
118 0.24
119 0.23
120 0.23
121 0.29
122 0.31
123 0.34
124 0.35
125 0.36
126 0.38
127 0.4
128 0.47
129 0.47
130 0.46
131 0.46
132 0.51
133 0.53
134 0.5
135 0.44
136 0.37
137 0.35
138 0.35
139 0.33