FuNGI

A0A015IZA9

Protein Details

Accession

A0A015IZA9

Localization Confidence

Low

Confidence Score

5.7

NoLS Segment(s)

Position	Sequence	Protein Nature
387-416	ISVLIFYKARQYRRKIKNKMNTYHQNISNN	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

extr 8, E.R. 7, plas 6, nucl 2, mito 2, golg 2, mito_nucl 2

Family & Domain DBs

InterPro	View protein in InterPro IPR011043 Gal_Oxase/kelch_b-propeller IPR015915 Kelch-typ_b-propeller IPR006652 Kelch_1
Gene Ontology	GO:0016020 C:membrane
Pfam	View protein in Pfam PF01344 Kelch_1

Amino Acid Sequences

MQLSKFIFSTVLIIFNHVIFTKCGTFGGNGLYSLFTGNKLYYVGFFEFNFFYVDLAGVSLDTDTIIDKSKWVDLTEIKPQPGIDSNIPLLSKDNEKLIILDNTDDDVNAYTFHTTSNQWEVNPTKVIKKKEFVGLGEWVSDENTGISYSFLDSTMSIFDSINLTLTKGVSTPENLSADIRIFEDSAQVLLNGQILFIGGGFSSFKNPMSSILMYNTRTDTWQMMNTVGETPEGRIKHTAVSTSDGRIIVFGGISNSLPASPQLSILDTSKTPYEWSTPMIENPFTLSDHAAVMVNNYMIVAFGINTRETIPTLIDNNNIYKLDIRDPLKYKWSFLSGFDSSDNFDSSLDVFKPTNSTPIKASVDSASRLGTRNTVIIVYAVMVFICISVLIFYKARQYRRKIKNKMNTYHQNISNNENISINEELEKSMT

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.19
2	0.18
3	0.2
4	0.17
5	0.17
6	0.13
7	0.18
8	0.17
9	0.17
10	0.17
11	0.17
12	0.17
13	0.17
14	0.22
15	0.19
16	0.17
17	0.17
18	0.17
19	0.15
20	0.16
21	0.15
22	0.11
23	0.12
24	0.12
25	0.12
26	0.12
27	0.13
28	0.12
29	0.16
30	0.17
31	0.17
32	0.17
33	0.19
34	0.19
35	0.19
36	0.2
37	0.15
38	0.13
39	0.11
40	0.11
41	0.08
42	0.08
43	0.07
44	0.05
45	0.05
46	0.05
47	0.04
48	0.04
49	0.04
50	0.05
51	0.06
52	0.1
53	0.09
54	0.11
55	0.13
56	0.17
57	0.18
58	0.18
59	0.21
60	0.23
61	0.28
62	0.37
63	0.39
64	0.36
65	0.35
66	0.34
67	0.33
68	0.32
69	0.33
70	0.25
71	0.24
72	0.25
73	0.27
74	0.27
75	0.24
76	0.22
77	0.2
78	0.21
79	0.19
80	0.2
81	0.19
82	0.19
83	0.2
84	0.21
85	0.21
86	0.17
87	0.17
88	0.15
89	0.15
90	0.15
91	0.13
92	0.1
93	0.09
94	0.08
95	0.08
96	0.08
97	0.08
98	0.08
99	0.08
100	0.1
101	0.1
102	0.13
103	0.19
104	0.2
105	0.2
106	0.25
107	0.27
108	0.28
109	0.31
110	0.29
111	0.31
112	0.36
113	0.43
114	0.42
115	0.44
116	0.44
117	0.46
118	0.48
119	0.41
120	0.38
121	0.35
122	0.3
123	0.27
124	0.23
125	0.16
126	0.14
127	0.12
128	0.09
129	0.05
130	0.05
131	0.05
132	0.05
133	0.05
134	0.05
135	0.06
136	0.06
137	0.06
138	0.07
139	0.06
140	0.07
141	0.07
142	0.08
143	0.08
144	0.07
145	0.07
146	0.08
147	0.08
148	0.09
149	0.08
150	0.08
151	0.08
152	0.08
153	0.08
154	0.07
155	0.08
156	0.07
157	0.09
158	0.1
159	0.13
160	0.14
161	0.14
162	0.14
163	0.14
164	0.14
165	0.13
166	0.11
167	0.08
168	0.08
169	0.07
170	0.08
171	0.07
172	0.07
173	0.06
174	0.06
175	0.05
176	0.05
177	0.07
178	0.06
179	0.05
180	0.05
181	0.05
182	0.05
183	0.04
184	0.04
185	0.02
186	0.03
187	0.04
188	0.04
189	0.06
190	0.07
191	0.07
192	0.08
193	0.08
194	0.1
195	0.12
196	0.13
197	0.12
198	0.14
199	0.17
200	0.18
201	0.18
202	0.18
203	0.15
204	0.14
205	0.14
206	0.13
207	0.11
208	0.12
209	0.12
210	0.12
211	0.12
212	0.12
213	0.11
214	0.1
215	0.09
216	0.07
217	0.08
218	0.11
219	0.11
220	0.12
221	0.12
222	0.13
223	0.15
224	0.16
225	0.17
226	0.14
227	0.18
228	0.18
229	0.18
230	0.19
231	0.16
232	0.16
233	0.13
234	0.12
235	0.08
236	0.07
237	0.06
238	0.05
239	0.05
240	0.05
241	0.05
242	0.05
243	0.05
244	0.05
245	0.05
246	0.06
247	0.06
248	0.07
249	0.07
250	0.08
251	0.1
252	0.1
253	0.12
254	0.11
255	0.12
256	0.11
257	0.11
258	0.11
259	0.11
260	0.13
261	0.13
262	0.15
263	0.17
264	0.18
265	0.2
266	0.21
267	0.2
268	0.17
269	0.18
270	0.17
271	0.14
272	0.13
273	0.12
274	0.1
275	0.1
276	0.1
277	0.09
278	0.08
279	0.08
280	0.08
281	0.07
282	0.06
283	0.06
284	0.05
285	0.04
286	0.04
287	0.04
288	0.03
289	0.05
290	0.07
291	0.07
292	0.08
293	0.09
294	0.1
295	0.1
296	0.11
297	0.1
298	0.11
299	0.14
300	0.15
301	0.17
302	0.18
303	0.19
304	0.21
305	0.2
306	0.18
307	0.18
308	0.2
309	0.21
310	0.26
311	0.27
312	0.32
313	0.36
314	0.39
315	0.45
316	0.43
317	0.41
318	0.37
319	0.4
320	0.34
321	0.32
322	0.36
323	0.28
324	0.29
325	0.28
326	0.25
327	0.22
328	0.22
329	0.21
330	0.14
331	0.13
332	0.12
333	0.11
334	0.14
335	0.13
336	0.14
337	0.14
338	0.14
339	0.18
340	0.18
341	0.26
342	0.24
343	0.26
344	0.25
345	0.32
346	0.35
347	0.32
348	0.33
349	0.29
350	0.3
351	0.3
352	0.29
353	0.24
354	0.22
355	0.23
356	0.22
357	0.21
358	0.19
359	0.18
360	0.18
361	0.16
362	0.15
363	0.13
364	0.12
365	0.1
366	0.09
367	0.07
368	0.06
369	0.06
370	0.05
371	0.05
372	0.05
373	0.04
374	0.03
375	0.04
376	0.06
377	0.09
378	0.1
379	0.11
380	0.21
381	0.27
382	0.36
383	0.44
384	0.52
385	0.6
386	0.71
387	0.81
388	0.82
389	0.87
390	0.89
391	0.91
392	0.9
393	0.9
394	0.9
395	0.87
396	0.86
397	0.82
398	0.78
399	0.7
400	0.66
401	0.62
402	0.54
403	0.46
404	0.38
405	0.32
406	0.29
407	0.28
408	0.24
409	0.2
410	0.18

A0A015IZA9

3D AlphaFold-predicted Structure Viewer