Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015I9A5

Protein Details
Accession A0A015I9A5    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-31LYEQRRIHKARLRRIRKEQLLRNIINHydrophilic
NLS Segment(s)
PositionSequence
13-21HKARLRRIR
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLSRNLYEQRRIHKARLRRIRKEQLLRNIINKTYTKKTSTFDQIVRSIPPQVNTETPLENNFYNGAVFQYHTDVLEPAGWDLSLFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.7
3 0.75
4 0.77
5 0.77
6 0.83
7 0.85
8 0.87
9 0.88
10 0.85
11 0.85
12 0.83
13 0.75
14 0.7
15 0.63
16 0.54
17 0.48
18 0.42
19 0.37
20 0.35
21 0.36
22 0.34
23 0.33
24 0.34
25 0.35
26 0.4
27 0.39
28 0.35
29 0.35
30 0.34
31 0.32
32 0.31
33 0.27
34 0.23
35 0.2
36 0.2
37 0.18
38 0.18
39 0.18
40 0.19
41 0.2
42 0.18
43 0.18
44 0.17
45 0.18
46 0.16
47 0.16
48 0.14
49 0.12
50 0.11
51 0.1
52 0.1
53 0.08
54 0.09
55 0.09
56 0.11
57 0.11
58 0.11
59 0.12
60 0.11
61 0.12
62 0.13
63 0.12
64 0.1
65 0.1
66 0.1