Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3KLI2

Protein Details
Accession J3KLI2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
336-362GMSERNLRLPRIRNRRRRSTLSDESINHydrophilic
NLS Segment(s)
PositionSequence
350-350R
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008402  APC_su15/mnd2  
Gene Ontology GO:0005680  C:anaphase-promoting complex  
GO:0031145  P:anaphase-promoting complex-dependent catabolic process  
GO:0030071  P:regulation of mitotic metaphase/anaphase transition  
KEGG cim:CIMG_02498  -  
Pfam View protein in Pfam  
PF05841  Apc15p  
Amino Acid Sequences MLSLPLIEPRDSHMLWFTPPHSRRTSYTAPAGNQTTNIRRNGQSRGASHVPPTSDSLAALMLEERALRIRKQNIASFGYSWIRPAGYPKTMQGIREEEAEREEAANAAMEGEMEFMGEVGLDGGIGGGEGDDLEEMERDLDDEIPEADEDEEEDEFSGGLVEDGEDGLDEDDLVEGEDEEEVLMERDLDDDIPEGFGIGHDDDDDDQEDEDFDEQPDLDDDIPSASPQEEDVSMMERDLDEDVPEQEWEHTDTDAEEDEEDDQSDGLHYSMTDRYFYQASHRPRSSISTLAENSPPLPPPLVRHRETEAQRLFLERWSGGIGDDVEDSMAAFRSSGMSERNLRLPRIRNRRRRSTLSDESINVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.3
4 0.28
5 0.32
6 0.35
7 0.4
8 0.42
9 0.44
10 0.46
11 0.5
12 0.55
13 0.51
14 0.56
15 0.55
16 0.52
17 0.54
18 0.53
19 0.46
20 0.42
21 0.42
22 0.42
23 0.42
24 0.44
25 0.43
26 0.44
27 0.48
28 0.51
29 0.53
30 0.51
31 0.47
32 0.51
33 0.51
34 0.47
35 0.46
36 0.43
37 0.36
38 0.31
39 0.34
40 0.28
41 0.23
42 0.22
43 0.19
44 0.16
45 0.14
46 0.12
47 0.09
48 0.07
49 0.07
50 0.07
51 0.07
52 0.11
53 0.14
54 0.16
55 0.23
56 0.28
57 0.35
58 0.41
59 0.45
60 0.46
61 0.48
62 0.48
63 0.41
64 0.4
65 0.36
66 0.3
67 0.26
68 0.22
69 0.18
70 0.16
71 0.2
72 0.22
73 0.22
74 0.24
75 0.24
76 0.31
77 0.32
78 0.33
79 0.32
80 0.3
81 0.27
82 0.31
83 0.31
84 0.23
85 0.23
86 0.23
87 0.19
88 0.16
89 0.15
90 0.1
91 0.09
92 0.08
93 0.06
94 0.06
95 0.05
96 0.04
97 0.04
98 0.05
99 0.04
100 0.04
101 0.04
102 0.03
103 0.03
104 0.03
105 0.03
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.02
119 0.02
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.04
126 0.04
127 0.05
128 0.05
129 0.05
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06
135 0.05
136 0.05
137 0.06
138 0.05
139 0.05
140 0.05
141 0.05
142 0.04
143 0.04
144 0.04
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.02
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.02
163 0.03
164 0.03
165 0.03
166 0.02
167 0.02
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.04
184 0.05
185 0.04
186 0.04
187 0.04
188 0.05
189 0.05
190 0.06
191 0.07
192 0.06
193 0.06
194 0.06
195 0.06
196 0.06
197 0.06
198 0.06
199 0.05
200 0.05
201 0.05
202 0.06
203 0.06
204 0.07
205 0.06
206 0.06
207 0.06
208 0.06
209 0.07
210 0.06
211 0.06
212 0.05
213 0.05
214 0.06
215 0.07
216 0.06
217 0.07
218 0.07
219 0.09
220 0.09
221 0.09
222 0.09
223 0.07
224 0.08
225 0.08
226 0.08
227 0.06
228 0.07
229 0.08
230 0.09
231 0.09
232 0.09
233 0.08
234 0.09
235 0.11
236 0.11
237 0.1
238 0.09
239 0.1
240 0.1
241 0.1
242 0.09
243 0.07
244 0.07
245 0.08
246 0.08
247 0.08
248 0.07
249 0.06
250 0.06
251 0.06
252 0.06
253 0.05
254 0.05
255 0.04
256 0.07
257 0.1
258 0.11
259 0.12
260 0.12
261 0.15
262 0.16
263 0.16
264 0.21
265 0.26
266 0.33
267 0.41
268 0.42
269 0.41
270 0.42
271 0.48
272 0.44
273 0.42
274 0.36
275 0.34
276 0.35
277 0.36
278 0.36
279 0.31
280 0.28
281 0.24
282 0.23
283 0.17
284 0.18
285 0.16
286 0.2
287 0.3
288 0.37
289 0.37
290 0.4
291 0.44
292 0.51
293 0.54
294 0.58
295 0.5
296 0.46
297 0.44
298 0.44
299 0.39
300 0.33
301 0.33
302 0.23
303 0.21
304 0.19
305 0.18
306 0.15
307 0.16
308 0.14
309 0.11
310 0.12
311 0.1
312 0.09
313 0.09
314 0.09
315 0.07
316 0.07
317 0.06
318 0.06
319 0.06
320 0.08
321 0.09
322 0.12
323 0.14
324 0.18
325 0.25
326 0.28
327 0.37
328 0.39
329 0.42
330 0.48
331 0.55
332 0.6
333 0.65
334 0.73
335 0.75
336 0.81
337 0.88
338 0.89
339 0.89
340 0.87
341 0.86
342 0.85
343 0.82
344 0.78