Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015KGV9

Protein Details
Accession A0A015KGV9   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MDEPPKKKKKGFTEEQRRKAMKTKRNNNIYTNCHydrophilic
NLS Segment(s)
PositionSequence
5-25PKKKKKGFTEEQRRKAMKTKR
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MDEPPKKKKKGFTEEQRRKAMKTKRNNNIYTNCGQVKRNNKIPNVEEFNPVNACLNANVPINWTQYINEKQNVKKKLKVLINIGAEPSAISNELRKDLNVPIVRKSNVILRIANGKSIASLGIAELEVEINQGLKIPLKVEVIESKQMDLILETDLLKHGVIDMKERLLTIKMNDEENEIPIDCKVQNKEDESSSKSNDIVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.91
4 0.82
5 0.75
6 0.74
7 0.73
8 0.71
9 0.71
10 0.73
11 0.73
12 0.8
13 0.82
14 0.81
15 0.77
16 0.74
17 0.65
18 0.61
19 0.56
20 0.49
21 0.47
22 0.46
23 0.5
24 0.52
25 0.58
26 0.58
27 0.57
28 0.61
29 0.61
30 0.63
31 0.61
32 0.55
33 0.51
34 0.45
35 0.43
36 0.36
37 0.34
38 0.26
39 0.18
40 0.17
41 0.12
42 0.12
43 0.12
44 0.13
45 0.12
46 0.13
47 0.16
48 0.17
49 0.17
50 0.16
51 0.14
52 0.2
53 0.26
54 0.27
55 0.29
56 0.32
57 0.38
58 0.45
59 0.53
60 0.5
61 0.49
62 0.5
63 0.53
64 0.54
65 0.52
66 0.5
67 0.49
68 0.47
69 0.42
70 0.38
71 0.3
72 0.24
73 0.19
74 0.14
75 0.07
76 0.05
77 0.05
78 0.06
79 0.07
80 0.09
81 0.09
82 0.09
83 0.11
84 0.12
85 0.19
86 0.21
87 0.21
88 0.23
89 0.26
90 0.27
91 0.25
92 0.25
93 0.23
94 0.23
95 0.24
96 0.21
97 0.18
98 0.25
99 0.24
100 0.24
101 0.2
102 0.16
103 0.13
104 0.13
105 0.12
106 0.05
107 0.05
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.03
115 0.04
116 0.04
117 0.03
118 0.03
119 0.04
120 0.05
121 0.06
122 0.06
123 0.07
124 0.1
125 0.1
126 0.11
127 0.12
128 0.17
129 0.18
130 0.24
131 0.23
132 0.21
133 0.21
134 0.21
135 0.19
136 0.15
137 0.12
138 0.08
139 0.08
140 0.08
141 0.07
142 0.08
143 0.09
144 0.08
145 0.07
146 0.07
147 0.11
148 0.11
149 0.15
150 0.16
151 0.18
152 0.18
153 0.19
154 0.19
155 0.17
156 0.18
157 0.16
158 0.23
159 0.23
160 0.25
161 0.26
162 0.29
163 0.28
164 0.27
165 0.27
166 0.19
167 0.18
168 0.15
169 0.18
170 0.15
171 0.2
172 0.22
173 0.26
174 0.31
175 0.34
176 0.38
177 0.41
178 0.45
179 0.46
180 0.47
181 0.45
182 0.42