Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015N3A9

Protein Details
Accession A0A015N3A9    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
23-49VNRTGTQLKKRNQKNKEDKNSLKRKYGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MDVEIWNRYGKNTNTAEAAHSLVNRTGTQLKKRNQKNKEDKNSLKRKYGQSKIQSIDENIYEFESDNSQSKKVDIEEIRLRLELEIEDRKMNLKET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.33
4 0.27
5 0.26
6 0.19
7 0.17
8 0.17
9 0.16
10 0.17
11 0.15
12 0.16
13 0.21
14 0.25
15 0.33
16 0.4
17 0.46
18 0.54
19 0.64
20 0.71
21 0.72
22 0.78
23 0.8
24 0.83
25 0.85
26 0.86
27 0.84
28 0.85
29 0.87
30 0.8
31 0.76
32 0.71
33 0.69
34 0.68
35 0.67
36 0.64
37 0.6
38 0.63
39 0.59
40 0.56
41 0.49
42 0.4
43 0.35
44 0.27
45 0.22
46 0.16
47 0.13
48 0.1
49 0.09
50 0.09
51 0.09
52 0.09
53 0.13
54 0.15
55 0.16
56 0.16
57 0.16
58 0.18
59 0.18
60 0.25
61 0.21
62 0.27
63 0.34
64 0.36
65 0.37
66 0.35
67 0.34
68 0.26
69 0.25
70 0.19
71 0.18
72 0.21
73 0.22
74 0.23
75 0.23
76 0.27