Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015ISJ8

Protein Details
Accession A0A015ISJ8    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
111-138VNVLWVKKVKNTKKKKNKDEIKEKMEEWHydrophilic
NLS Segment(s)
PositionSequence
79-129KKKLANNHSVKAEKDERNEKKIKGENKNEKANVNVLWVKKVKNTKKKKNKD
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 9
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSGITYFIIFIALFILCMTIIITSFSFMIPFNENKNDQDRQNNLNELEQNRKLIYQESWVLKLECLQCYERFERFERWKKKLANNHSVKAEKDERNEKKIKGENKNEKANVNVLWVKKVKNTKKKKNKDEIKEKMEEWMIERMEDNEWLREWMDGVVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.05
6 0.04
7 0.05
8 0.06
9 0.06
10 0.07
11 0.08
12 0.07
13 0.08
14 0.08
15 0.1
16 0.12
17 0.14
18 0.18
19 0.23
20 0.25
21 0.27
22 0.33
23 0.34
24 0.34
25 0.4
26 0.41
27 0.4
28 0.42
29 0.43
30 0.38
31 0.38
32 0.39
33 0.33
34 0.36
35 0.33
36 0.3
37 0.27
38 0.26
39 0.24
40 0.22
41 0.2
42 0.17
43 0.21
44 0.21
45 0.22
46 0.23
47 0.23
48 0.2
49 0.24
50 0.23
51 0.18
52 0.19
53 0.19
54 0.19
55 0.23
56 0.27
57 0.24
58 0.25
59 0.26
60 0.31
61 0.38
62 0.47
63 0.5
64 0.51
65 0.57
66 0.6
67 0.65
68 0.66
69 0.66
70 0.66
71 0.64
72 0.63
73 0.6
74 0.56
75 0.49
76 0.46
77 0.46
78 0.38
79 0.38
80 0.45
81 0.44
82 0.5
83 0.54
84 0.49
85 0.5
86 0.53
87 0.57
88 0.56
89 0.63
90 0.66
91 0.69
92 0.76
93 0.7
94 0.64
95 0.57
96 0.5
97 0.4
98 0.34
99 0.31
100 0.23
101 0.26
102 0.28
103 0.27
104 0.3
105 0.4
106 0.45
107 0.51
108 0.62
109 0.68
110 0.77
111 0.87
112 0.92
113 0.93
114 0.93
115 0.93
116 0.93
117 0.92
118 0.89
119 0.82
120 0.72
121 0.66
122 0.58
123 0.48
124 0.4
125 0.36
126 0.29
127 0.25
128 0.25
129 0.21
130 0.2
131 0.24
132 0.23
133 0.19
134 0.19
135 0.2
136 0.2
137 0.18
138 0.18