Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015M1M8

Protein Details
Accession A0A015M1M8    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-26EDRPLGRPPHKTRRRSTAPGBasic
NLS Segment(s)
PositionSequence
13-20RPPHKTRR
Subcellular Location(s) nucl 14, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MPKARSEDRPLGRPPHKTRRRSTAPGHCTNPTIWVCPRAACARRAALIARPGSAPAALRSPPPAPPASCRPWQRPLGPSGPLAAGRRCGGSGTAPKAAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.71
3 0.74
4 0.76
5 0.78
6 0.78
7 0.81
8 0.79
9 0.79
10 0.79
11 0.78
12 0.77
13 0.74
14 0.65
15 0.58
16 0.5
17 0.47
18 0.37
19 0.32
20 0.26
21 0.25
22 0.24
23 0.22
24 0.25
25 0.25
26 0.27
27 0.25
28 0.26
29 0.25
30 0.25
31 0.25
32 0.23
33 0.19
34 0.21
35 0.2
36 0.18
37 0.16
38 0.15
39 0.14
40 0.14
41 0.11
42 0.07
43 0.09
44 0.09
45 0.1
46 0.12
47 0.13
48 0.15
49 0.17
50 0.19
51 0.18
52 0.22
53 0.29
54 0.32
55 0.38
56 0.42
57 0.45
58 0.5
59 0.54
60 0.55
61 0.52
62 0.52
63 0.49
64 0.46
65 0.4
66 0.35
67 0.31
68 0.29
69 0.28
70 0.24
71 0.23
72 0.21
73 0.22
74 0.2
75 0.2
76 0.17
77 0.21
78 0.28
79 0.29