Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015LIN8

Protein Details
Accession A0A015LIN8   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
96-122LEQEINKRKGKNRKRRTDKEEREKIYKBasic
NLS Segment(s)
PositionSequence
102-117KRKGKNRKRRTDKEER
Subcellular Location(s) nucl 26
Family & Domain DBs
Amino Acid Sequences MEIDDKNDKVREKEEDNSSEKNGTDDSEENEEIVRSENYQVLMIRLKHKKEDIDEEMLEKENGGLSLLQLCHKMRRNNQMLLEIHYYLGKRFEERLEQEINKRKGKNRKRRTDKEEREKIYKEMLETDVVRTRKGLKRMMEKAEKVCLLVNKIGKKRVFESNCDITSVDSCTKKEITEIAEDLIRGQEIEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.53
4 0.53
5 0.51
6 0.46
7 0.41
8 0.35
9 0.27
10 0.22
11 0.21
12 0.19
13 0.2
14 0.24
15 0.24
16 0.22
17 0.22
18 0.21
19 0.17
20 0.18
21 0.14
22 0.1
23 0.12
24 0.13
25 0.14
26 0.15
27 0.15
28 0.15
29 0.19
30 0.21
31 0.28
32 0.33
33 0.34
34 0.37
35 0.41
36 0.43
37 0.42
38 0.48
39 0.44
40 0.43
41 0.41
42 0.38
43 0.36
44 0.32
45 0.27
46 0.19
47 0.14
48 0.08
49 0.08
50 0.07
51 0.06
52 0.05
53 0.08
54 0.09
55 0.09
56 0.12
57 0.13
58 0.19
59 0.25
60 0.32
61 0.35
62 0.45
63 0.5
64 0.52
65 0.53
66 0.53
67 0.48
68 0.45
69 0.41
70 0.31
71 0.25
72 0.22
73 0.2
74 0.14
75 0.16
76 0.12
77 0.1
78 0.12
79 0.13
80 0.16
81 0.19
82 0.22
83 0.23
84 0.24
85 0.3
86 0.38
87 0.42
88 0.42
89 0.43
90 0.47
91 0.54
92 0.63
93 0.68
94 0.69
95 0.75
96 0.81
97 0.88
98 0.9
99 0.91
100 0.91
101 0.9
102 0.89
103 0.83
104 0.78
105 0.7
106 0.63
107 0.56
108 0.47
109 0.36
110 0.3
111 0.26
112 0.22
113 0.21
114 0.22
115 0.23
116 0.22
117 0.22
118 0.2
119 0.26
120 0.29
121 0.34
122 0.38
123 0.38
124 0.48
125 0.55
126 0.63
127 0.63
128 0.62
129 0.59
130 0.58
131 0.51
132 0.42
133 0.38
134 0.32
135 0.27
136 0.29
137 0.31
138 0.33
139 0.38
140 0.44
141 0.44
142 0.45
143 0.45
144 0.51
145 0.49
146 0.47
147 0.51
148 0.51
149 0.49
150 0.47
151 0.43
152 0.34
153 0.32
154 0.3
155 0.28
156 0.23
157 0.23
158 0.26
159 0.27
160 0.25
161 0.26
162 0.26
163 0.23
164 0.26
165 0.26
166 0.24
167 0.25
168 0.24
169 0.23
170 0.2
171 0.17