Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015KYH0

Protein Details
Accession A0A015KYH0   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-39ALAYLREVKNRCKKPKIFNEFCETMHydrophilic
250-270LETGLRRSTRNRKIASKPVDDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003822  PAH  
IPR036600  PAH_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS51477  PAH  
Amino Acid Sequences MSHQNLKQEKGIEIALAYLREVKNRCKKPKIFNEFCETMRSFKRKEISESFCHDIVKNLFKDDPELLEGFYIYFPRQKNLLTSPSSTTCITPQQREVEEKNDVLIDKENNNMNIDNQNLVIDNIENENDNKLNFQGNDCESHIIVNNEGEENKIIINQELENENISNIHQGIKTAFINEFYTNSHLSKKEASDLSTVISNSSLSSSSSPQNSFKNIESFDNDDNNNITLLKPSSSTKKKEITSSPASNSLETGLRRSTRNRKIASKPVDDAYFFYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.17
3 0.15
4 0.14
5 0.17
6 0.17
7 0.23
8 0.27
9 0.35
10 0.44
11 0.54
12 0.63
13 0.67
14 0.75
15 0.8
16 0.88
17 0.89
18 0.87
19 0.82
20 0.81
21 0.74
22 0.67
23 0.63
24 0.53
25 0.47
26 0.46
27 0.46
28 0.39
29 0.42
30 0.48
31 0.45
32 0.52
33 0.56
34 0.54
35 0.55
36 0.59
37 0.58
38 0.52
39 0.49
40 0.41
41 0.38
42 0.36
43 0.37
44 0.31
45 0.29
46 0.29
47 0.28
48 0.31
49 0.26
50 0.23
51 0.19
52 0.18
53 0.16
54 0.14
55 0.14
56 0.11
57 0.11
58 0.1
59 0.08
60 0.12
61 0.13
62 0.15
63 0.17
64 0.17
65 0.21
66 0.25
67 0.3
68 0.29
69 0.3
70 0.32
71 0.33
72 0.35
73 0.31
74 0.27
75 0.22
76 0.28
77 0.3
78 0.28
79 0.3
80 0.32
81 0.34
82 0.38
83 0.38
84 0.34
85 0.33
86 0.3
87 0.27
88 0.23
89 0.2
90 0.17
91 0.17
92 0.14
93 0.12
94 0.16
95 0.17
96 0.17
97 0.18
98 0.18
99 0.16
100 0.16
101 0.16
102 0.13
103 0.11
104 0.11
105 0.1
106 0.09
107 0.08
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.08
115 0.08
116 0.08
117 0.08
118 0.08
119 0.1
120 0.1
121 0.1
122 0.12
123 0.13
124 0.15
125 0.15
126 0.16
127 0.13
128 0.13
129 0.14
130 0.11
131 0.1
132 0.08
133 0.08
134 0.07
135 0.07
136 0.07
137 0.06
138 0.06
139 0.06
140 0.06
141 0.06
142 0.06
143 0.07
144 0.07
145 0.08
146 0.09
147 0.09
148 0.09
149 0.09
150 0.09
151 0.08
152 0.08
153 0.07
154 0.07
155 0.08
156 0.08
157 0.08
158 0.09
159 0.11
160 0.11
161 0.12
162 0.12
163 0.11
164 0.14
165 0.14
166 0.14
167 0.13
168 0.15
169 0.16
170 0.16
171 0.19
172 0.17
173 0.19
174 0.21
175 0.21
176 0.25
177 0.24
178 0.25
179 0.23
180 0.22
181 0.22
182 0.2
183 0.19
184 0.13
185 0.12
186 0.1
187 0.09
188 0.09
189 0.09
190 0.08
191 0.1
192 0.12
193 0.15
194 0.19
195 0.22
196 0.24
197 0.27
198 0.3
199 0.31
200 0.32
201 0.33
202 0.31
203 0.32
204 0.32
205 0.33
206 0.33
207 0.34
208 0.31
209 0.27
210 0.26
211 0.24
212 0.21
213 0.16
214 0.13
215 0.12
216 0.13
217 0.13
218 0.14
219 0.17
220 0.27
221 0.34
222 0.4
223 0.44
224 0.51
225 0.53
226 0.59
227 0.62
228 0.6
229 0.62
230 0.62
231 0.59
232 0.58
233 0.56
234 0.49
235 0.42
236 0.36
237 0.32
238 0.26
239 0.26
240 0.25
241 0.27
242 0.3
243 0.39
244 0.48
245 0.53
246 0.61
247 0.65
248 0.68
249 0.74
250 0.81
251 0.81
252 0.77
253 0.71
254 0.68
255 0.64
256 0.56