Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015KA33

Protein Details
Accession A0A015KA33   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
111-137AVLRKSEDIPHKQRRKARPRKVKQIVVHydrophilic
NLS Segment(s)
PositionSequence
105-133KKGSRGAVLRKSEDIPHKQRRKARPRKVK
Subcellular Location(s) nucl 26
Family & Domain DBs
Amino Acid Sequences MVTDQNHSFDSAPIEQEVSRYEKIAKRIADMDNALSEKMGALDEKMDNYYSEYKKSVKRLERDVGSLEDELENLDEYVVEDLDECVDRETVVDLIHEIVLSLIGKKGSRGAVLRKSEDIPHKQRRKARPRKVKQIVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.18
4 0.19
5 0.2
6 0.18
7 0.18
8 0.24
9 0.26
10 0.31
11 0.37
12 0.35
13 0.33
14 0.37
15 0.38
16 0.36
17 0.33
18 0.29
19 0.26
20 0.25
21 0.22
22 0.17
23 0.14
24 0.1
25 0.09
26 0.08
27 0.05
28 0.05
29 0.07
30 0.08
31 0.09
32 0.1
33 0.1
34 0.09
35 0.12
36 0.19
37 0.18
38 0.2
39 0.21
40 0.25
41 0.29
42 0.35
43 0.41
44 0.41
45 0.45
46 0.49
47 0.53
48 0.51
49 0.48
50 0.43
51 0.36
52 0.3
53 0.26
54 0.19
55 0.13
56 0.11
57 0.09
58 0.07
59 0.06
60 0.04
61 0.04
62 0.03
63 0.04
64 0.04
65 0.04
66 0.03
67 0.04
68 0.04
69 0.05
70 0.05
71 0.05
72 0.05
73 0.06
74 0.06
75 0.06
76 0.07
77 0.07
78 0.06
79 0.06
80 0.06
81 0.06
82 0.07
83 0.06
84 0.05
85 0.04
86 0.05
87 0.05
88 0.05
89 0.06
90 0.07
91 0.08
92 0.08
93 0.12
94 0.13
95 0.16
96 0.2
97 0.27
98 0.34
99 0.4
100 0.42
101 0.42
102 0.42
103 0.45
104 0.5
105 0.52
106 0.53
107 0.59
108 0.65
109 0.7
110 0.77
111 0.82
112 0.85
113 0.86
114 0.88
115 0.88
116 0.9
117 0.93