Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JUR8

Protein Details
Accession A0A015JUR8   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-43NIPTDNKKIKPTKSTKRKPKNKGGETEDKGBasic
NLS Segment(s)
PositionSequence
20-75KKIKPTKSTKRKPKNKGGETEDKGGPEDKGGKTKKIEILLGKIFHRPHKKLPRSVK
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
Amino Acid Sequences MTESEKSEEIESRNIPTDNKKIKPTKSTKRKPKNKGGETEDKGGPEDKGGKTKKIEILLGKIFHRPHKKLPRSVKPPSQSPFFPNLAFLTNIQTNQYNQKVSKNFANFKNDVDTAAANANSSGTGVQNLQYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.34
4 0.41
5 0.44
6 0.48
7 0.54
8 0.57
9 0.62
10 0.7
11 0.74
12 0.75
13 0.77
14 0.83
15 0.85
16 0.89
17 0.93
18 0.92
19 0.93
20 0.93
21 0.89
22 0.88
23 0.84
24 0.84
25 0.77
26 0.73
27 0.63
28 0.52
29 0.45
30 0.37
31 0.28
32 0.2
33 0.21
34 0.17
35 0.24
36 0.25
37 0.28
38 0.29
39 0.33
40 0.35
41 0.32
42 0.34
43 0.27
44 0.3
45 0.3
46 0.3
47 0.26
48 0.26
49 0.26
50 0.3
51 0.35
52 0.33
53 0.4
54 0.49
55 0.54
56 0.59
57 0.68
58 0.71
59 0.72
60 0.76
61 0.75
62 0.68
63 0.69
64 0.63
65 0.57
66 0.48
67 0.45
68 0.43
69 0.37
70 0.32
71 0.27
72 0.24
73 0.22
74 0.21
75 0.17
76 0.16
77 0.15
78 0.16
79 0.16
80 0.16
81 0.16
82 0.22
83 0.26
84 0.25
85 0.25
86 0.33
87 0.35
88 0.37
89 0.43
90 0.44
91 0.48
92 0.5
93 0.57
94 0.5
95 0.49
96 0.51
97 0.43
98 0.36
99 0.31
100 0.25
101 0.19
102 0.21
103 0.19
104 0.13
105 0.13
106 0.12
107 0.1
108 0.1
109 0.09
110 0.06
111 0.08
112 0.09