Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015JKX4

Protein Details
Accession A0A015JKX4    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MKAFYKLIKKNRKRKSGEAFGEDHydrophilic
NLS Segment(s)
PositionSequence
9-15KKNRKRK
Subcellular Location(s) mito 19.5, cyto_mito 11.5, nucl 5
Family & Domain DBs
Amino Acid Sequences MKAFYKLIKKNRKRKSGEAFGEDFDYIYGIVTTASEWYFILFASDGISSTSKDPLNIRFSESALKEGSEEEKICVKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.86
4 0.82
5 0.78
6 0.7
7 0.6
8 0.54
9 0.44
10 0.34
11 0.22
12 0.16
13 0.09
14 0.07
15 0.06
16 0.04
17 0.04
18 0.03
19 0.04
20 0.04
21 0.04
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.04
29 0.04
30 0.05
31 0.05
32 0.05
33 0.06
34 0.07
35 0.07
36 0.08
37 0.12
38 0.11
39 0.13
40 0.16
41 0.2
42 0.25
43 0.25
44 0.28
45 0.26
46 0.27
47 0.31
48 0.3
49 0.27
50 0.23
51 0.22
52 0.19
53 0.19
54 0.21
55 0.19
56 0.19
57 0.19