Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015JAV8

Protein Details
Accession A0A015JAV8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
79-99KRLQNSPKDKVIKKRWRVEEKBasic
NLS Segment(s)
PositionSequence
92-93KR
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MESYRTCGVTQSIGIGEHDISQRAIEKRRENYKLVFGVEIIRMAERHEVIQKYTTLNEKFTKRLKDENRDKDLVSECEKRLQNSPKDKVIKKRWRVEEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.13
4 0.13
5 0.14
6 0.13
7 0.12
8 0.12
9 0.17
10 0.2
11 0.26
12 0.31
13 0.37
14 0.44
15 0.53
16 0.57
17 0.55
18 0.54
19 0.54
20 0.5
21 0.44
22 0.36
23 0.27
24 0.24
25 0.21
26 0.18
27 0.12
28 0.09
29 0.08
30 0.09
31 0.1
32 0.08
33 0.09
34 0.13
35 0.13
36 0.14
37 0.15
38 0.15
39 0.15
40 0.16
41 0.21
42 0.18
43 0.21
44 0.25
45 0.26
46 0.3
47 0.35
48 0.4
49 0.37
50 0.46
51 0.51
52 0.57
53 0.65
54 0.69
55 0.7
56 0.66
57 0.63
58 0.57
59 0.53
60 0.47
61 0.42
62 0.38
63 0.33
64 0.39
65 0.4
66 0.38
67 0.43
68 0.48
69 0.51
70 0.56
71 0.61
72 0.62
73 0.7
74 0.74
75 0.76
76 0.78
77 0.8
78 0.79
79 0.84