Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015MZG7

Protein Details
Accession A0A015MZG7   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPKVTTKKQYNDKVPKKRKSLTATHydrophilic
NLS Segment(s)
PositionSequence
16-18KKR
Subcellular Location(s) nucl 22, mito_nucl 12.833, cyto_nucl 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences MPKVTTKKQYNDKVPKKRKSLTATQKKEIYLRKISKPFLKQKELANEYEVSEEMISDILKAKDRWLYIDLNNSHQSWFEMRKKTSIHYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.88
4 0.85
5 0.83
6 0.78
7 0.79
8 0.79
9 0.79
10 0.77
11 0.75
12 0.72
13 0.64
14 0.63
15 0.59
16 0.54
17 0.53
18 0.51
19 0.53
20 0.55
21 0.58
22 0.59
23 0.61
24 0.64
25 0.61
26 0.61
27 0.56
28 0.55
29 0.6
30 0.56
31 0.49
32 0.41
33 0.34
34 0.29
35 0.27
36 0.22
37 0.12
38 0.09
39 0.08
40 0.06
41 0.06
42 0.05
43 0.04
44 0.07
45 0.08
46 0.11
47 0.11
48 0.13
49 0.17
50 0.18
51 0.2
52 0.21
53 0.24
54 0.23
55 0.32
56 0.32
57 0.33
58 0.36
59 0.33
60 0.31
61 0.28
62 0.27
63 0.24
64 0.31
65 0.33
66 0.39
67 0.4
68 0.46
69 0.48