Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015K4R7

Protein Details
Accession A0A015K4R7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
81-100VIITVCYCKRDRRPRNNGQVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, plas 6, extr 5, E.R. 3, vacu 3, cyto 1, pero 1, golg 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MILITTTNLLNDSLQRIITKYSIILLLLLNILINNNSSGFGVLGDTGNEENDNNNMKGVQLKYQIPIGLGIGCAAVIIIIVIITVCYCKRDRRPRNNGQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.17
5 0.16
6 0.15
7 0.12
8 0.12
9 0.12
10 0.11
11 0.11
12 0.09
13 0.08
14 0.07
15 0.07
16 0.06
17 0.05
18 0.05
19 0.04
20 0.05
21 0.05
22 0.05
23 0.05
24 0.06
25 0.06
26 0.06
27 0.05
28 0.05
29 0.05
30 0.05
31 0.04
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.07
39 0.1
40 0.09
41 0.09
42 0.09
43 0.09
44 0.13
45 0.14
46 0.15
47 0.17
48 0.18
49 0.19
50 0.21
51 0.21
52 0.17
53 0.17
54 0.13
55 0.1
56 0.09
57 0.07
58 0.06
59 0.05
60 0.04
61 0.04
62 0.03
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.04
72 0.05
73 0.09
74 0.12
75 0.21
76 0.32
77 0.43
78 0.55
79 0.65
80 0.75