Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JBX8

Protein Details
Accession A0A015JBX8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
55-77APRSGHPKKLTVRDKRKFKGNFYBasic
NLS Segment(s)
PositionSequence
62-63KK
67-70RDKR
Subcellular Location(s) mito 11, nucl 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR036388  WH-like_DNA-bd_sf  
Amino Acid Sequences MVKTKELTDFERGKVISYYKAGDTEIAISEKTGYGKTTIHNIITKYRKTGAITVAPRSGHPKKLTVRDKRKFKGNFYCIHWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.26
4 0.24
5 0.25
6 0.2
7 0.21
8 0.2
9 0.17
10 0.16
11 0.14
12 0.13
13 0.11
14 0.1
15 0.09
16 0.09
17 0.1
18 0.1
19 0.09
20 0.08
21 0.08
22 0.1
23 0.1
24 0.15
25 0.16
26 0.17
27 0.18
28 0.19
29 0.25
30 0.3
31 0.3
32 0.27
33 0.28
34 0.29
35 0.28
36 0.3
37 0.27
38 0.29
39 0.31
40 0.31
41 0.33
42 0.3
43 0.29
44 0.34
45 0.34
46 0.33
47 0.33
48 0.38
49 0.41
50 0.52
51 0.61
52 0.64
53 0.71
54 0.74
55 0.83
56 0.81
57 0.84
58 0.8
59 0.8
60 0.8
61 0.76
62 0.73