Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015JRR1

Protein Details
Accession A0A015JRR1    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
28-47SDPTKKRNTHSQRTSCPWRVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13.333, mito_nucl 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR014842  AFT  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0036086  P:positive regulation of transcription from RNA polymerase II promoter in response to iron ion starvation  
Pfam View protein in Pfam  
PF08731  AFT  
Amino Acid Sequences MSEYIEGVLRRVTYECTKSGSHISQATSDPTKKRNTHSQRTSCPWRVNLTYPKTSNIVKINSFNDVHNHPLTSMIQEIAPRFWKLTQEMLADVEKYVVQRRMDSMSIYPLLKHDYPNQPIYMKDLYNAVYQFRKKNNLETVMLRKCFNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.29
4 0.3
5 0.31
6 0.36
7 0.34
8 0.32
9 0.31
10 0.31
11 0.3
12 0.3
13 0.32
14 0.31
15 0.34
16 0.33
17 0.35
18 0.43
19 0.44
20 0.49
21 0.55
22 0.59
23 0.65
24 0.72
25 0.76
26 0.74
27 0.79
28 0.82
29 0.78
30 0.73
31 0.65
32 0.59
33 0.54
34 0.53
35 0.54
36 0.5
37 0.5
38 0.46
39 0.45
40 0.43
41 0.4
42 0.38
43 0.34
44 0.31
45 0.26
46 0.29
47 0.28
48 0.29
49 0.29
50 0.25
51 0.23
52 0.21
53 0.22
54 0.19
55 0.18
56 0.14
57 0.15
58 0.14
59 0.12
60 0.11
61 0.08
62 0.08
63 0.09
64 0.09
65 0.09
66 0.11
67 0.1
68 0.11
69 0.11
70 0.13
71 0.14
72 0.16
73 0.18
74 0.17
75 0.17
76 0.18
77 0.18
78 0.16
79 0.14
80 0.11
81 0.09
82 0.09
83 0.12
84 0.15
85 0.15
86 0.16
87 0.18
88 0.21
89 0.22
90 0.22
91 0.19
92 0.18
93 0.2
94 0.2
95 0.18
96 0.15
97 0.2
98 0.19
99 0.21
100 0.24
101 0.31
102 0.35
103 0.38
104 0.39
105 0.36
106 0.35
107 0.38
108 0.34
109 0.25
110 0.21
111 0.21
112 0.2
113 0.23
114 0.24
115 0.22
116 0.25
117 0.3
118 0.36
119 0.4
120 0.48
121 0.47
122 0.55
123 0.6
124 0.59
125 0.58
126 0.59
127 0.62
128 0.62
129 0.61