Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D8JU87

Protein Details
Accession A0A0D8JU87    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
74-100AGIRGASRKHPKLKRWPYKMLKNSTPLHydrophilic
NLS Segment(s)
PositionSequence
80-88SRKHPKLKR
Subcellular Location(s) mito 14, cyto 6, cyto_nucl 6, nucl 4
Family & Domain DBs
KEGG cim:CIMG_11698  -  
Amino Acid Sequences MVVTKEMVKLVGWVAGALRMSVLKAGIQGIGFLHLLFYPQIYAFGEIDGSLRGMAKYQICVSSVVTDSIELCGAGIRGASRKHPKLKRWPYKMLKNSTPLTSAMMDETDQSGGQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.11
4 0.09
5 0.09
6 0.07
7 0.07
8 0.08
9 0.08
10 0.06
11 0.07
12 0.07
13 0.08
14 0.07
15 0.08
16 0.07
17 0.08
18 0.08
19 0.07
20 0.07
21 0.06
22 0.07
23 0.06
24 0.06
25 0.05
26 0.05
27 0.07
28 0.07
29 0.09
30 0.08
31 0.08
32 0.08
33 0.07
34 0.07
35 0.07
36 0.06
37 0.04
38 0.04
39 0.04
40 0.05
41 0.07
42 0.07
43 0.08
44 0.09
45 0.1
46 0.1
47 0.11
48 0.11
49 0.11
50 0.11
51 0.1
52 0.1
53 0.09
54 0.08
55 0.08
56 0.08
57 0.05
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.08
65 0.09
66 0.17
67 0.26
68 0.33
69 0.43
70 0.51
71 0.6
72 0.68
73 0.78
74 0.81
75 0.81
76 0.84
77 0.84
78 0.87
79 0.88
80 0.85
81 0.8
82 0.76
83 0.71
84 0.63
85 0.55
86 0.45
87 0.39
88 0.31
89 0.25
90 0.2
91 0.17
92 0.15
93 0.14
94 0.14
95 0.12