Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JHZ9

Protein Details
Accession A0A015JHZ9   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-29IYNTHVASKKPPKKLHRNNKKICNSSHYHydrophilic
NLS Segment(s)
PositionSequence
10-19KKPPKKLHRN
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MIYNTHVASKKPPKKLHRNNKKICNSSHYNNNGRSRSSTIIGIGCGNDAIIPSAYHRYSYSSTKISNYNNNNNSSPSTTSKHYSKKDLYNSTYSYYNVDIKSKKAELMKNGVSTIPNNNNDNNYNQRFSILSLPDNNNNNNNTKSLHHSYNGSSSNNVKLIKKSHRNTTTTIVNNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.88
3 0.9
4 0.9
5 0.92
6 0.93
7 0.94
8 0.94
9 0.89
10 0.82
11 0.79
12 0.75
13 0.7
14 0.7
15 0.67
16 0.64
17 0.65
18 0.69
19 0.64
20 0.58
21 0.56
22 0.51
23 0.46
24 0.4
25 0.33
26 0.27
27 0.25
28 0.23
29 0.2
30 0.16
31 0.12
32 0.1
33 0.09
34 0.06
35 0.05
36 0.06
37 0.06
38 0.06
39 0.07
40 0.12
41 0.12
42 0.13
43 0.13
44 0.16
45 0.19
46 0.22
47 0.25
48 0.24
49 0.25
50 0.27
51 0.32
52 0.32
53 0.37
54 0.4
55 0.45
56 0.46
57 0.49
58 0.47
59 0.43
60 0.41
61 0.35
62 0.31
63 0.26
64 0.24
65 0.23
66 0.25
67 0.3
68 0.36
69 0.37
70 0.4
71 0.41
72 0.46
73 0.51
74 0.53
75 0.5
76 0.46
77 0.45
78 0.41
79 0.37
80 0.3
81 0.24
82 0.2
83 0.2
84 0.17
85 0.2
86 0.19
87 0.19
88 0.23
89 0.22
90 0.23
91 0.25
92 0.28
93 0.27
94 0.33
95 0.35
96 0.32
97 0.32
98 0.29
99 0.25
100 0.23
101 0.25
102 0.25
103 0.26
104 0.27
105 0.28
106 0.3
107 0.31
108 0.34
109 0.36
110 0.33
111 0.31
112 0.29
113 0.29
114 0.26
115 0.26
116 0.28
117 0.22
118 0.21
119 0.25
120 0.29
121 0.34
122 0.37
123 0.38
124 0.36
125 0.37
126 0.38
127 0.34
128 0.32
129 0.28
130 0.27
131 0.33
132 0.34
133 0.35
134 0.33
135 0.34
136 0.35
137 0.4
138 0.42
139 0.36
140 0.33
141 0.32
142 0.34
143 0.36
144 0.36
145 0.31
146 0.33
147 0.4
148 0.48
149 0.56
150 0.57
151 0.63
152 0.68
153 0.69
154 0.69
155 0.68
156 0.66