Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015K4U2

Protein Details
Accession A0A015K4U2    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MKASAIRARTKRKRSEVTLNRTLQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, mito_nucl 14, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021027  Transposase_put_HTH  
Pfam View protein in Pfam  
PF12323  HTH_OrfB_IS605  
Amino Acid Sequences MKASAIRARTKRKRSEVTLNRTLQVKVYPNHSQKQLLKRWMGLARFAYSSVVKWSKSDIDIQAGINVDKVNDKKLINSAIWGERKFLRAVALTARNEVIKRNIQHAQSESVSSLSFRTRKDLQQTVTIRAQNFSSTVFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.84
4 0.83
5 0.83
6 0.75
7 0.68
8 0.61
9 0.54
10 0.44
11 0.39
12 0.36
13 0.28
14 0.33
15 0.39
16 0.42
17 0.47
18 0.48
19 0.5
20 0.51
21 0.58
22 0.6
23 0.58
24 0.55
25 0.51
26 0.54
27 0.51
28 0.45
29 0.4
30 0.34
31 0.29
32 0.27
33 0.26
34 0.21
35 0.17
36 0.16
37 0.18
38 0.18
39 0.17
40 0.16
41 0.18
42 0.18
43 0.19
44 0.22
45 0.17
46 0.17
47 0.18
48 0.17
49 0.17
50 0.15
51 0.14
52 0.11
53 0.1
54 0.07
55 0.09
56 0.1
57 0.1
58 0.13
59 0.13
60 0.13
61 0.16
62 0.18
63 0.15
64 0.16
65 0.17
66 0.19
67 0.23
68 0.22
69 0.22
70 0.21
71 0.23
72 0.22
73 0.2
74 0.16
75 0.14
76 0.15
77 0.19
78 0.23
79 0.22
80 0.23
81 0.23
82 0.22
83 0.22
84 0.23
85 0.22
86 0.22
87 0.23
88 0.28
89 0.32
90 0.33
91 0.37
92 0.37
93 0.37
94 0.31
95 0.31
96 0.26
97 0.21
98 0.2
99 0.16
100 0.15
101 0.16
102 0.19
103 0.19
104 0.25
105 0.29
106 0.35
107 0.43
108 0.49
109 0.46
110 0.52
111 0.54
112 0.54
113 0.56
114 0.54
115 0.46
116 0.4
117 0.38
118 0.31
119 0.28