Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015LQX7

Protein Details
Accession A0A015LQX7    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
99-139KVGGVKKKRKQLDTNDNNNNLERNNSSNNNKKLKKRKKRKRHydrophilic
NLS Segment(s)
PositionSequence
100-108VGGVKKKRK
129-139KKLKKRKKRKR
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MITQIKKEEINVIMIENTEKIKEILEKIEENKVQMLNFFEAKEVRINEMNKTTMDYQSRDRYEHDRCNNGRRGFNNFKVIQLIKNINNRKEEEKGDEGKVGGVKKKRKQLDTNDNNNNLERNNSSNNNKKLKKRKKRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.14
4 0.14
5 0.11
6 0.11
7 0.1
8 0.12
9 0.15
10 0.16
11 0.19
12 0.22
13 0.25
14 0.26
15 0.34
16 0.33
17 0.31
18 0.31
19 0.28
20 0.24
21 0.23
22 0.23
23 0.18
24 0.18
25 0.17
26 0.16
27 0.15
28 0.16
29 0.19
30 0.16
31 0.17
32 0.21
33 0.22
34 0.23
35 0.26
36 0.26
37 0.21
38 0.23
39 0.22
40 0.21
41 0.23
42 0.22
43 0.24
44 0.3
45 0.32
46 0.3
47 0.31
48 0.33
49 0.37
50 0.44
51 0.43
52 0.44
53 0.45
54 0.51
55 0.57
56 0.54
57 0.51
58 0.44
59 0.49
60 0.47
61 0.48
62 0.48
63 0.41
64 0.38
65 0.38
66 0.37
67 0.29
68 0.27
69 0.27
70 0.25
71 0.33
72 0.38
73 0.38
74 0.41
75 0.43
76 0.42
77 0.42
78 0.4
79 0.37
80 0.37
81 0.37
82 0.35
83 0.33
84 0.29
85 0.27
86 0.27
87 0.24
88 0.24
89 0.27
90 0.35
91 0.41
92 0.5
93 0.56
94 0.61
95 0.67
96 0.73
97 0.77
98 0.78
99 0.82
100 0.82
101 0.78
102 0.72
103 0.65
104 0.55
105 0.45
106 0.38
107 0.3
108 0.26
109 0.29
110 0.35
111 0.42
112 0.5
113 0.58
114 0.65
115 0.7
116 0.75
117 0.8
118 0.84
119 0.87