Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015K648

Protein Details
Accession A0A015K648   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MSLYKQHRNKVAHKEKWKPEDKNKGQRKEATHydrophilic
NLS Segment(s)
PositionSequence
10-28KVAHKEKWKPEDKNKGQRK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 3
Family & Domain DBs
Amino Acid Sequences MSLYKQHRNKVAHKEKWKPEDKNKGQRKEATKNALECIKIATKIRNNPELIFAFEKCVKDLDCLTIVSQCITIYRRDNPGIILY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.86
4 0.87
5 0.84
6 0.84
7 0.85
8 0.85
9 0.86
10 0.86
11 0.84
12 0.81
13 0.8
14 0.78
15 0.75
16 0.73
17 0.69
18 0.64
19 0.57
20 0.53
21 0.48
22 0.4
23 0.31
24 0.26
25 0.2
26 0.18
27 0.18
28 0.21
29 0.23
30 0.29
31 0.33
32 0.35
33 0.35
34 0.33
35 0.37
36 0.32
37 0.3
38 0.27
39 0.23
40 0.21
41 0.23
42 0.23
43 0.19
44 0.2
45 0.17
46 0.17
47 0.18
48 0.18
49 0.16
50 0.16
51 0.16
52 0.17
53 0.16
54 0.15
55 0.14
56 0.11
57 0.13
58 0.13
59 0.18
60 0.2
61 0.25
62 0.31
63 0.33
64 0.34