Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015N9A0

Protein Details
Accession A0A015N9A0    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
103-127KDKNGHVRLKKLNVKRIRQKTPLPQHydrophilic
NLS Segment(s)
PositionSequence
42-44RSK
112-113KK
117-117K
Subcellular Location(s) nucl 19.5, mito_nucl 12.666, cyto_nucl 12.333, mito 4.5
Family & Domain DBs
Amino Acid Sequences MKAEDRELARQRAKKSLQKGVLEQCPSKSTTRRCVLLGKGRRSKKISYPSRRIIKEHCLLKQVKKCQKLKLINTPSLVLKTSGDDDVPRATAGTRVITVIKVKDKNGHVRLKKLNVKRIRQKTPLPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.66
3 0.67
4 0.67
5 0.65
6 0.68
7 0.66
8 0.66
9 0.62
10 0.56
11 0.48
12 0.43
13 0.41
14 0.39
15 0.38
16 0.38
17 0.43
18 0.47
19 0.46
20 0.46
21 0.49
22 0.52
23 0.54
24 0.56
25 0.56
26 0.59
27 0.62
28 0.67
29 0.65
30 0.62
31 0.61
32 0.63
33 0.64
34 0.65
35 0.69
36 0.71
37 0.75
38 0.73
39 0.68
40 0.62
41 0.58
42 0.55
43 0.51
44 0.44
45 0.42
46 0.42
47 0.46
48 0.48
49 0.5
50 0.51
51 0.55
52 0.57
53 0.57
54 0.64
55 0.65
56 0.65
57 0.66
58 0.65
59 0.61
60 0.58
61 0.52
62 0.44
63 0.36
64 0.31
65 0.21
66 0.15
67 0.12
68 0.12
69 0.11
70 0.11
71 0.1
72 0.11
73 0.11
74 0.11
75 0.1
76 0.08
77 0.08
78 0.1
79 0.11
80 0.11
81 0.1
82 0.11
83 0.11
84 0.13
85 0.15
86 0.18
87 0.24
88 0.26
89 0.27
90 0.34
91 0.39
92 0.48
93 0.54
94 0.6
95 0.57
96 0.63
97 0.69
98 0.72
99 0.75
100 0.74
101 0.76
102 0.75
103 0.81
104 0.83
105 0.85
106 0.84
107 0.83