Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JBS2

Protein Details
Accession A0A015JBS2    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-53YKKYNNQKSTPRERIKLTKKKNKCVSQKNHNKHFFVRKSKKEKEEGKETQKHydrophilic
195-214LKENCNRLRRERNAAHHRAEHydrophilic
NLS Segment(s)
PositionSequence
14-25RERIKLTKKKNK
29-46QKNHNKHFFVRKSKKEKE
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MVYKKYNNQKSTPRERIKLTKKKNKCVSQKNHNKHFFVRKSKKEKEEGKETQKLSQRAVRVASEFFLQNRELREEIIQLRQEVQELQEEVQVREDFSIIKSSQESQVRQELQQQVQQLQQQLSSLQEQLQEASSRDELVEQQQASLPLTNSEQYQLVAENEIMLNDIQERDDFIQRLKNERVNEHLAFRRQISALKENCNRLRRERNAAHHRAEGMIVLLRNRDNSRNPPSSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.81
4 0.83
5 0.83
6 0.83
7 0.83
8 0.84
9 0.89
10 0.92
11 0.91
12 0.91
13 0.91
14 0.9
15 0.91
16 0.92
17 0.91
18 0.92
19 0.89
20 0.82
21 0.8
22 0.8
23 0.78
24 0.78
25 0.78
26 0.78
27 0.81
28 0.86
29 0.86
30 0.84
31 0.84
32 0.81
33 0.81
34 0.8
35 0.79
36 0.77
37 0.7
38 0.68
39 0.66
40 0.6
41 0.54
42 0.49
43 0.43
44 0.39
45 0.4
46 0.35
47 0.3
48 0.28
49 0.24
50 0.21
51 0.19
52 0.16
53 0.16
54 0.15
55 0.15
56 0.16
57 0.19
58 0.17
59 0.17
60 0.18
61 0.19
62 0.2
63 0.23
64 0.22
65 0.2
66 0.21
67 0.2
68 0.2
69 0.16
70 0.15
71 0.13
72 0.12
73 0.12
74 0.13
75 0.14
76 0.14
77 0.17
78 0.16
79 0.13
80 0.12
81 0.12
82 0.1
83 0.1
84 0.14
85 0.1
86 0.11
87 0.11
88 0.12
89 0.18
90 0.22
91 0.22
92 0.21
93 0.27
94 0.27
95 0.27
96 0.32
97 0.31
98 0.29
99 0.3
100 0.28
101 0.24
102 0.25
103 0.26
104 0.22
105 0.17
106 0.15
107 0.13
108 0.13
109 0.12
110 0.11
111 0.1
112 0.08
113 0.09
114 0.09
115 0.1
116 0.1
117 0.1
118 0.1
119 0.12
120 0.11
121 0.1
122 0.1
123 0.1
124 0.09
125 0.11
126 0.14
127 0.12
128 0.12
129 0.13
130 0.14
131 0.14
132 0.14
133 0.12
134 0.09
135 0.11
136 0.11
137 0.1
138 0.11
139 0.1
140 0.09
141 0.1
142 0.09
143 0.09
144 0.09
145 0.08
146 0.08
147 0.07
148 0.07
149 0.07
150 0.06
151 0.06
152 0.06
153 0.06
154 0.06
155 0.06
156 0.08
157 0.1
158 0.14
159 0.15
160 0.15
161 0.22
162 0.23
163 0.3
164 0.33
165 0.36
166 0.35
167 0.38
168 0.42
169 0.43
170 0.43
171 0.42
172 0.43
173 0.42
174 0.41
175 0.39
176 0.36
177 0.3
178 0.33
179 0.33
180 0.36
181 0.36
182 0.43
183 0.48
184 0.54
185 0.61
186 0.63
187 0.62
188 0.62
189 0.68
190 0.67
191 0.71
192 0.71
193 0.74
194 0.78
195 0.81
196 0.76
197 0.69
198 0.63
199 0.54
200 0.45
201 0.35
202 0.26
203 0.21
204 0.18
205 0.16
206 0.17
207 0.18
208 0.23
209 0.26
210 0.31
211 0.35
212 0.42
213 0.51