Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JMC2

Protein Details
Accession A0A015JMC2    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
94-120YKQPWNFNKSKWRRKSNYIVAIKKFRNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 10.5, mito 6.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004672  F:protein kinase activity  
GO:0006468  P:protein phosphorylation  
PROSITE View protein in PROSITE  
PS50011  PROTEIN_KINASE_DOM  
Amino Acid Sequences MDEYYRCQKCGQIYGKDYCKSCNSVRFRDNFAHWTSGDSNLDEMIQNSQQNADRSYKLIEWIEYSNFENIELIAHGGFGNVYKAIWKDGPLINYKQPWNFNKSKWRRKSNYIVAIKKFRNTTHASSEFLDERK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.63
3 0.64
4 0.59
5 0.54
6 0.5
7 0.47
8 0.46
9 0.47
10 0.46
11 0.5
12 0.56
13 0.55
14 0.56
15 0.55
16 0.54
17 0.49
18 0.45
19 0.4
20 0.33
21 0.33
22 0.3
23 0.28
24 0.26
25 0.21
26 0.19
27 0.15
28 0.16
29 0.12
30 0.11
31 0.09
32 0.1
33 0.1
34 0.1
35 0.12
36 0.15
37 0.16
38 0.19
39 0.19
40 0.18
41 0.19
42 0.21
43 0.19
44 0.18
45 0.17
46 0.15
47 0.14
48 0.15
49 0.14
50 0.14
51 0.14
52 0.12
53 0.12
54 0.11
55 0.09
56 0.07
57 0.07
58 0.05
59 0.05
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.05
70 0.06
71 0.08
72 0.09
73 0.1
74 0.13
75 0.16
76 0.19
77 0.22
78 0.25
79 0.27
80 0.31
81 0.33
82 0.33
83 0.39
84 0.4
85 0.44
86 0.46
87 0.48
88 0.55
89 0.63
90 0.69
91 0.72
92 0.78
93 0.77
94 0.81
95 0.85
96 0.84
97 0.84
98 0.83
99 0.81
100 0.77
101 0.8
102 0.74
103 0.69
104 0.63
105 0.54
106 0.51
107 0.49
108 0.48
109 0.49
110 0.49
111 0.46
112 0.44
113 0.47