Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JTL8

Protein Details
Accession A0A015JTL8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
88-110AFFFTRRKKQIIKNNINIRNPNDHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, extr 7, mito 4, vacu 3, E.R. 2, golg 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSQFFKMKLFLILFLAFTIVAVQGSAQNQEDPKKTSTVFVTSTSVAASPTSTPAGNNSLPGTTLVDSIGPIVAASIVVFLIIVILIAAFFFTRRKKQIIKNNINIRNPNDPNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.11
4 0.1
5 0.09
6 0.06
7 0.05
8 0.04
9 0.05
10 0.07
11 0.08
12 0.1
13 0.1
14 0.12
15 0.14
16 0.18
17 0.21
18 0.23
19 0.24
20 0.25
21 0.24
22 0.25
23 0.25
24 0.24
25 0.23
26 0.22
27 0.22
28 0.2
29 0.19
30 0.17
31 0.15
32 0.11
33 0.09
34 0.08
35 0.06
36 0.07
37 0.08
38 0.08
39 0.07
40 0.09
41 0.13
42 0.12
43 0.12
44 0.12
45 0.1
46 0.11
47 0.11
48 0.11
49 0.08
50 0.08
51 0.07
52 0.07
53 0.06
54 0.06
55 0.06
56 0.04
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.03
77 0.08
78 0.13
79 0.21
80 0.25
81 0.32
82 0.4
83 0.5
84 0.6
85 0.68
86 0.73
87 0.76
88 0.83
89 0.85
90 0.84
91 0.81
92 0.75
93 0.74