Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3KHK1

Protein Details
Accession J3KHK1    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
17-49ALREYFAAKRRRRRANGRRTRHGRRRSARCHDSBasic
NLS Segment(s)
PositionSequence
24-43AKRRRRRANGRRTRHGRRRS
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
KEGG cim:CIMG_00708  -  
Amino Acid Sequences MIAVPREGRGFRLGDGALREYFAAKRRRRRANGRRTRHGRRRSARCHDSGDGAATPRRVVRSPITRFMPIYQNTNSKIIKLNYKKKKAPEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.23
4 0.19
5 0.18
6 0.18
7 0.15
8 0.18
9 0.22
10 0.29
11 0.34
12 0.44
13 0.53
14 0.64
15 0.71
16 0.8
17 0.83
18 0.85
19 0.89
20 0.88
21 0.89
22 0.87
23 0.89
24 0.88
25 0.86
26 0.85
27 0.84
28 0.85
29 0.84
30 0.85
31 0.79
32 0.72
33 0.68
34 0.58
35 0.51
36 0.41
37 0.33
38 0.24
39 0.2
40 0.18
41 0.13
42 0.13
43 0.12
44 0.14
45 0.13
46 0.16
47 0.22
48 0.31
49 0.36
50 0.42
51 0.45
52 0.44
53 0.45
54 0.45
55 0.45
56 0.37
57 0.37
58 0.34
59 0.36
60 0.37
61 0.42
62 0.39
63 0.33
64 0.38
65 0.37
66 0.43
67 0.48
68 0.56
69 0.6
70 0.7
71 0.75