Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3KC94

Protein Details
Accession J3KC94    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
168-187AYYERKKATRRQLAQAQRTAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito_nucl 9.833, cyto_nucl 8.833, mito 8.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005822  Ribosomal_L13  
IPR023563  Ribosomal_L13_CS  
IPR005755  Ribosomal_L13_euk/arc  
IPR036899  Ribosomal_L13_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cim:CIMG_03852  -  
Pfam View protein in Pfam  
PF00572  Ribosomal_L13  
PROSITE View protein in PROSITE  
PS00783  RIBOSOMAL_L13  
CDD cd00392  Ribosomal_L13  
Amino Acid Sequences MSTFEPVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHAYLRKITRFNPTRGGPFHFRAPSRIFYKAVRGMIPHKTPRGAAAMERLKVFEGVPPPYDKKKRVVVPQALRILRLKPGRKYCTVGRLSHEVGWKYQDVVARLEERRKAKSSAYYERKKATRRQLAQAQRTASVSQQTKEQLASYGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.1
4 0.1
5 0.11
6 0.11
7 0.11
8 0.11
9 0.11
10 0.15
11 0.16
12 0.15
13 0.14
14 0.21
15 0.28
16 0.3
17 0.29
18 0.26
19 0.26
20 0.28
21 0.29
22 0.23
23 0.17
24 0.16
25 0.16
26 0.17
27 0.14
28 0.13
29 0.14
30 0.12
31 0.12
32 0.12
33 0.12
34 0.11
35 0.11
36 0.14
37 0.13
38 0.14
39 0.18
40 0.22
41 0.29
42 0.37
43 0.45
44 0.45
45 0.52
46 0.56
47 0.6
48 0.59
49 0.54
50 0.56
51 0.54
52 0.53
53 0.53
54 0.49
55 0.46
56 0.45
57 0.48
58 0.43
59 0.4
60 0.43
61 0.39
62 0.37
63 0.36
64 0.37
65 0.37
66 0.35
67 0.35
68 0.31
69 0.27
70 0.33
71 0.33
72 0.31
73 0.26
74 0.25
75 0.25
76 0.29
77 0.34
78 0.31
79 0.28
80 0.27
81 0.26
82 0.26
83 0.25
84 0.2
85 0.15
86 0.2
87 0.21
88 0.21
89 0.21
90 0.2
91 0.18
92 0.17
93 0.17
94 0.12
95 0.11
96 0.12
97 0.13
98 0.16
99 0.19
100 0.26
101 0.32
102 0.32
103 0.34
104 0.4
105 0.45
106 0.5
107 0.56
108 0.58
109 0.58
110 0.63
111 0.66
112 0.58
113 0.54
114 0.47
115 0.39
116 0.36
117 0.38
118 0.36
119 0.36
120 0.46
121 0.49
122 0.51
123 0.55
124 0.52
125 0.55
126 0.54
127 0.49
128 0.43
129 0.44
130 0.43
131 0.42
132 0.42
133 0.34
134 0.3
135 0.3
136 0.26
137 0.22
138 0.22
139 0.21
140 0.18
141 0.19
142 0.21
143 0.23
144 0.26
145 0.3
146 0.34
147 0.36
148 0.39
149 0.41
150 0.41
151 0.4
152 0.47
153 0.5
154 0.54
155 0.61
156 0.63
157 0.66
158 0.71
159 0.73
160 0.71
161 0.72
162 0.72
163 0.73
164 0.7
165 0.74
166 0.76
167 0.79
168 0.81
169 0.78
170 0.69
171 0.6
172 0.57
173 0.48
174 0.41
175 0.39
176 0.35
177 0.3
178 0.32
179 0.33
180 0.33
181 0.33
182 0.31