Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3K8Y3

Protein Details
Accession J3K8Y3    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
61-91RMETRKRGGCKRDDRPKKNKIKGRSLQARIABasic
NLS Segment(s)
PositionSequence
65-84RKRGGCKRDDRPKKNKIKGR
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
KEGG cim:CIMG_06797  -  
Amino Acid Sequences MNASEAGTIEFKNTLSRENACSQEPVVSKSIHSSSENRYVPFLTGVGREERNRLHPYGVLRMETRKRGGCKRDDRPKKNKIKGRSLQARIAFGMWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.23
4 0.26
5 0.3
6 0.32
7 0.29
8 0.3
9 0.27
10 0.29
11 0.27
12 0.25
13 0.23
14 0.21
15 0.19
16 0.22
17 0.23
18 0.19
19 0.21
20 0.21
21 0.23
22 0.33
23 0.34
24 0.31
25 0.3
26 0.28
27 0.26
28 0.23
29 0.19
30 0.1
31 0.09
32 0.1
33 0.12
34 0.13
35 0.13
36 0.15
37 0.16
38 0.21
39 0.23
40 0.22
41 0.21
42 0.21
43 0.23
44 0.28
45 0.28
46 0.24
47 0.22
48 0.28
49 0.32
50 0.33
51 0.35
52 0.33
53 0.38
54 0.45
55 0.51
56 0.54
57 0.6
58 0.67
59 0.74
60 0.79
61 0.83
62 0.85
63 0.88
64 0.9
65 0.9
66 0.88
67 0.86
68 0.86
69 0.84
70 0.85
71 0.85
72 0.8
73 0.78
74 0.74
75 0.67
76 0.57