Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015LFW2

Protein Details
Accession A0A015LFW2   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPQVAKHKRVVKRKAFKSNVKRTSYSHydrophilic
NLS Segment(s)
PositionSequence
7-17HKRVVKRKAFK
Subcellular Location(s) nucl 19, mito_nucl 14, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR006600  HTH_CenpB_DNA-bd_dom  
Pfam View protein in Pfam  
PF03221  HTH_Tnp_Tc5  
PROSITE View protein in PROSITE  
PS51253  HTH_CENPB  
Amino Acid Sequences MPQVAKHKRVVKRKAFKSNVKRTSYSIKQKEEVVNYAKEYGKNNAATHFGINKIEKKLYDWIIEQRKQGFAVNYSLIRVKMLEILRDQDIIVLYGNLTNDFKMSNRWLYAFMKRQKLSLRRHTKISQKLPQQTEQLLESFYRFVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.89
4 0.9
5 0.91
6 0.89
7 0.84
8 0.77
9 0.7
10 0.7
11 0.7
12 0.69
13 0.67
14 0.63
15 0.58
16 0.62
17 0.63
18 0.57
19 0.52
20 0.46
21 0.39
22 0.35
23 0.37
24 0.33
25 0.3
26 0.29
27 0.27
28 0.29
29 0.3
30 0.29
31 0.27
32 0.28
33 0.26
34 0.25
35 0.23
36 0.19
37 0.19
38 0.21
39 0.23
40 0.23
41 0.24
42 0.22
43 0.23
44 0.27
45 0.26
46 0.26
47 0.24
48 0.29
49 0.36
50 0.38
51 0.37
52 0.33
53 0.32
54 0.3
55 0.3
56 0.23
57 0.16
58 0.16
59 0.15
60 0.14
61 0.14
62 0.14
63 0.12
64 0.11
65 0.1
66 0.08
67 0.12
68 0.12
69 0.13
70 0.13
71 0.15
72 0.16
73 0.16
74 0.15
75 0.11
76 0.1
77 0.09
78 0.08
79 0.06
80 0.06
81 0.06
82 0.07
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.08
89 0.11
90 0.14
91 0.17
92 0.17
93 0.18
94 0.22
95 0.25
96 0.33
97 0.38
98 0.42
99 0.48
100 0.47
101 0.5
102 0.56
103 0.61
104 0.63
105 0.65
106 0.68
107 0.63
108 0.7
109 0.73
110 0.73
111 0.75
112 0.75
113 0.73
114 0.72
115 0.78
116 0.76
117 0.74
118 0.69
119 0.61
120 0.54
121 0.47
122 0.38
123 0.31
124 0.26
125 0.22