Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015KQ98

Protein Details
Accession A0A015KQ98    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-34KEAAKSTSGGKNKKKKWSKGKVKDKANNAVVHydrophilic
NLS Segment(s)
PositionSequence
7-28AKSTSGGKNKKKKWSKGKVKDK
Subcellular Location(s) nucl 18, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MVKKEAAKSTSGGKNKKKKWSKGKVKDKANNAVVLDKATYDKLFKEVPTYKLITPSVLVDRLRVNGSLARVAIRELEEKGLIRKISTHGSQLIYTRATATAAMDKPES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.7
3 0.79
4 0.81
5 0.83
6 0.86
7 0.88
8 0.9
9 0.9
10 0.93
11 0.92
12 0.93
13 0.9
14 0.86
15 0.84
16 0.75
17 0.67
18 0.57
19 0.49
20 0.39
21 0.32
22 0.24
23 0.15
24 0.13
25 0.11
26 0.11
27 0.1
28 0.1
29 0.11
30 0.13
31 0.12
32 0.18
33 0.21
34 0.23
35 0.26
36 0.28
37 0.26
38 0.28
39 0.28
40 0.21
41 0.18
42 0.17
43 0.15
44 0.15
45 0.15
46 0.12
47 0.13
48 0.14
49 0.15
50 0.13
51 0.13
52 0.12
53 0.13
54 0.13
55 0.12
56 0.11
57 0.11
58 0.11
59 0.11
60 0.11
61 0.11
62 0.11
63 0.12
64 0.12
65 0.13
66 0.15
67 0.18
68 0.17
69 0.15
70 0.17
71 0.18
72 0.23
73 0.24
74 0.25
75 0.25
76 0.27
77 0.29
78 0.28
79 0.28
80 0.23
81 0.22
82 0.2
83 0.16
84 0.15
85 0.13
86 0.14
87 0.18
88 0.19