Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015LP07

Protein Details
Accession A0A015LP07    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
17-41ANDDLKYKRKYKELKKKIREMEEENBasic
NLS Segment(s)
PositionSequence
24-35KRKYKELKKKIR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSSKSRQKQPTFKAVAANDDLKYKRKYKELKKKIREMEEENEKLSLKLTRAKKNIQRLKIERSFLFDRLEQSQPTNESESDTTSSPPRAIDSEEDLSSVGSDSNDDNGSHAISMKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.57
3 0.51
4 0.46
5 0.36
6 0.36
7 0.36
8 0.34
9 0.38
10 0.39
11 0.39
12 0.45
13 0.55
14 0.6
15 0.69
16 0.75
17 0.81
18 0.84
19 0.89
20 0.88
21 0.86
22 0.81
23 0.75
24 0.72
25 0.7
26 0.62
27 0.53
28 0.46
29 0.38
30 0.31
31 0.27
32 0.2
33 0.12
34 0.18
35 0.25
36 0.32
37 0.36
38 0.44
39 0.49
40 0.58
41 0.64
42 0.63
43 0.65
44 0.6
45 0.65
46 0.62
47 0.59
48 0.48
49 0.47
50 0.43
51 0.36
52 0.34
53 0.27
54 0.24
55 0.25
56 0.27
57 0.21
58 0.2
59 0.2
60 0.2
61 0.21
62 0.21
63 0.17
64 0.17
65 0.17
66 0.18
67 0.18
68 0.17
69 0.16
70 0.16
71 0.17
72 0.16
73 0.15
74 0.15
75 0.14
76 0.16
77 0.17
78 0.21
79 0.23
80 0.23
81 0.23
82 0.21
83 0.2
84 0.17
85 0.15
86 0.09
87 0.06
88 0.07
89 0.07
90 0.1
91 0.12
92 0.11
93 0.13
94 0.13
95 0.14
96 0.13