Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015K255

Protein Details
Accession A0A015K255    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MNVKSCMERRRSNRKRRPSGRIHKFLNLHydrophilic
NLS Segment(s)
PositionSequence
9-21RRRSNRKRRPSGR
Subcellular Location(s) nucl 14, mito_nucl 11.833, cyto_nucl 8.833, mito 8.5
Family & Domain DBs
Amino Acid Sequences MNVKSCMERRRSNRKRRPSGRIHKFLNLTQRGTVVEINQEFTLMIFPISPTQGAFDFLIYYTANYSAQYIDEDGMEKFGNLLISLPNVHSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.91
3 0.91
4 0.92
5 0.91
6 0.92
7 0.91
8 0.9
9 0.83
10 0.78
11 0.72
12 0.66
13 0.65
14 0.58
15 0.48
16 0.4
17 0.36
18 0.3
19 0.28
20 0.25
21 0.16
22 0.16
23 0.14
24 0.15
25 0.14
26 0.13
27 0.11
28 0.11
29 0.1
30 0.06
31 0.05
32 0.04
33 0.04
34 0.05
35 0.05
36 0.05
37 0.05
38 0.06
39 0.06
40 0.08
41 0.08
42 0.08
43 0.08
44 0.08
45 0.09
46 0.08
47 0.08
48 0.07
49 0.08
50 0.08
51 0.08
52 0.08
53 0.07
54 0.08
55 0.09
56 0.09
57 0.08
58 0.08
59 0.09
60 0.09
61 0.1
62 0.1
63 0.08
64 0.08
65 0.09
66 0.09
67 0.08
68 0.09
69 0.08
70 0.1
71 0.11