Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JT15

Protein Details
Accession A0A015JT15   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
70-95ILNNPNKQTKPKGRPKGTKRLKASHEHydrophilic
NLS Segment(s)
PositionSequence
78-93TKPKGRPKGTKRLKAS
Subcellular Location(s) mito 12.5, mito_nucl 12.166, nucl 10.5, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MFWSFKCETKYITDSKVCYTINWKEGHIKWNISTKSFTSVVNLFLQKINQNRSTKLSGPRLFNKENSPFILNNPNKQTKPKGRPKGTKRLKASHEKEKCTQYKCGNCGDLGHNKRNCNILR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.45
4 0.38
5 0.34
6 0.37
7 0.36
8 0.37
9 0.37
10 0.35
11 0.37
12 0.4
13 0.44
14 0.41
15 0.37
16 0.34
17 0.41
18 0.41
19 0.35
20 0.35
21 0.3
22 0.31
23 0.3
24 0.27
25 0.21
26 0.21
27 0.21
28 0.22
29 0.22
30 0.17
31 0.17
32 0.18
33 0.19
34 0.22
35 0.25
36 0.28
37 0.3
38 0.31
39 0.34
40 0.37
41 0.38
42 0.4
43 0.45
44 0.42
45 0.45
46 0.49
47 0.51
48 0.48
49 0.46
50 0.45
51 0.4
52 0.37
53 0.35
54 0.31
55 0.26
56 0.26
57 0.34
58 0.3
59 0.31
60 0.36
61 0.4
62 0.38
63 0.42
64 0.49
65 0.49
66 0.59
67 0.64
68 0.68
69 0.72
70 0.81
71 0.86
72 0.88
73 0.87
74 0.87
75 0.83
76 0.81
77 0.79
78 0.79
79 0.78
80 0.78
81 0.76
82 0.72
83 0.71
84 0.72
85 0.71
86 0.64
87 0.66
88 0.64
89 0.65
90 0.62
91 0.63
92 0.55
93 0.49
94 0.48
95 0.46
96 0.47
97 0.46
98 0.52
99 0.5
100 0.51
101 0.53