Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015LIP8

Protein Details
Accession A0A015LIP8    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
54-73ITHKNKKRLFENKKHWQQQTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR033375  Cggbp1  
Gene Ontology GO:0005634  C:nucleus  
GO:0003690  F:double-stranded DNA binding  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Amino Acid Sequences MTKRRRTEHYTVNTRVKEIPGEFLVDNGILYCNFCDHSIDWMRKSTVDDHLNIITHKNKKRLFENKKHWQQQTIDTTLSSSESKKAIIHDLIEAFTITDIPLEKVNFLLVFFKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.59
3 0.5
4 0.45
5 0.36
6 0.33
7 0.24
8 0.27
9 0.24
10 0.21
11 0.2
12 0.15
13 0.14
14 0.09
15 0.09
16 0.06
17 0.06
18 0.06
19 0.06
20 0.07
21 0.08
22 0.1
23 0.09
24 0.16
25 0.22
26 0.25
27 0.26
28 0.27
29 0.28
30 0.26
31 0.27
32 0.24
33 0.24
34 0.24
35 0.24
36 0.23
37 0.24
38 0.24
39 0.22
40 0.22
41 0.2
42 0.25
43 0.28
44 0.34
45 0.36
46 0.39
47 0.48
48 0.56
49 0.61
50 0.64
51 0.7
52 0.73
53 0.8
54 0.84
55 0.77
56 0.71
57 0.64
58 0.62
59 0.58
60 0.5
61 0.4
62 0.32
63 0.31
64 0.26
65 0.25
66 0.18
67 0.12
68 0.12
69 0.12
70 0.13
71 0.14
72 0.16
73 0.19
74 0.19
75 0.19
76 0.2
77 0.2
78 0.19
79 0.18
80 0.17
81 0.12
82 0.1
83 0.09
84 0.06
85 0.06
86 0.07
87 0.08
88 0.12
89 0.12
90 0.13
91 0.13
92 0.15
93 0.14
94 0.14