Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015KTP7

Protein Details
Accession A0A015KTP7   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MTEQQQDDKPKQRLKRKDTKNMWWNVPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito_nucl 11.833, cyto_nucl 9.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MTEQQQDDKPKQRLKRKDTKNMWWNVPMTKACHRLFQVNKTPLDTDLEQTFKSQIQAHYPNKIRELDDSSEWIKLWNAVHSIVIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.84
4 0.86
5 0.87
6 0.88
7 0.87
8 0.83
9 0.77
10 0.71
11 0.63
12 0.54
13 0.5
14 0.41
15 0.36
16 0.36
17 0.4
18 0.36
19 0.38
20 0.38
21 0.4
22 0.42
23 0.46
24 0.49
25 0.46
26 0.45
27 0.42
28 0.42
29 0.34
30 0.34
31 0.26
32 0.19
33 0.16
34 0.17
35 0.15
36 0.15
37 0.16
38 0.13
39 0.14
40 0.15
41 0.14
42 0.2
43 0.3
44 0.32
45 0.4
46 0.44
47 0.45
48 0.46
49 0.47
50 0.41
51 0.36
52 0.39
53 0.34
54 0.3
55 0.31
56 0.29
57 0.28
58 0.27
59 0.23
60 0.18
61 0.18
62 0.17
63 0.17
64 0.18
65 0.17