Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015IEJ1

Protein Details
Accession A0A015IEJ1   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
95-117DERKKNNLRKKIHQTNKKRLFIKBasic
NLS Segment(s)
PositionSequence
98-113KKNNLRKKIHQTNKKR
Subcellular Location(s) mito 15, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR013761  SAM/pointed_sf  
Amino Acid Sequences MSSYISFRTHCSTLFLKSLPNNTNKLIISMSPLSHLIRINSIITNSHIQFSKSLSHNHYTTKSTKYNNDNIHGHILYYLKEDKLSSKDFDWGNIDERKKNNLRKKIHQTNKKRLFIKRNIIQVNFDALEDFTEWLSNLRFKKWAPMFEGMKWQDIIQLNDEQLLEKGIKTFTVRSELLYYFNIIKAAKAEKDAKKESSGISVTKDDKDKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.3
4 0.33
5 0.41
6 0.42
7 0.44
8 0.43
9 0.41
10 0.46
11 0.4
12 0.37
13 0.31
14 0.25
15 0.25
16 0.24
17 0.23
18 0.19
19 0.21
20 0.2
21 0.21
22 0.22
23 0.18
24 0.17
25 0.19
26 0.19
27 0.18
28 0.18
29 0.16
30 0.18
31 0.22
32 0.2
33 0.21
34 0.2
35 0.2
36 0.2
37 0.21
38 0.25
39 0.23
40 0.27
41 0.29
42 0.33
43 0.34
44 0.37
45 0.38
46 0.36
47 0.37
48 0.38
49 0.39
50 0.39
51 0.45
52 0.47
53 0.52
54 0.53
55 0.55
56 0.5
57 0.46
58 0.47
59 0.4
60 0.33
61 0.26
62 0.22
63 0.16
64 0.17
65 0.17
66 0.12
67 0.12
68 0.13
69 0.14
70 0.17
71 0.19
72 0.18
73 0.17
74 0.22
75 0.22
76 0.23
77 0.23
78 0.2
79 0.22
80 0.26
81 0.27
82 0.26
83 0.27
84 0.33
85 0.37
86 0.45
87 0.49
88 0.53
89 0.58
90 0.63
91 0.73
92 0.76
93 0.79
94 0.8
95 0.81
96 0.83
97 0.86
98 0.84
99 0.78
100 0.75
101 0.75
102 0.73
103 0.73
104 0.67
105 0.66
106 0.62
107 0.58
108 0.52
109 0.44
110 0.38
111 0.29
112 0.23
113 0.15
114 0.11
115 0.11
116 0.1
117 0.09
118 0.06
119 0.06
120 0.06
121 0.07
122 0.08
123 0.12
124 0.13
125 0.14
126 0.17
127 0.17
128 0.27
129 0.3
130 0.33
131 0.33
132 0.4
133 0.41
134 0.4
135 0.49
136 0.4
137 0.38
138 0.34
139 0.29
140 0.27
141 0.27
142 0.27
143 0.21
144 0.21
145 0.2
146 0.21
147 0.21
148 0.16
149 0.13
150 0.13
151 0.11
152 0.09
153 0.11
154 0.09
155 0.11
156 0.12
157 0.15
158 0.15
159 0.21
160 0.21
161 0.22
162 0.26
163 0.25
164 0.26
165 0.25
166 0.25
167 0.2
168 0.2
169 0.21
170 0.16
171 0.16
172 0.17
173 0.21
174 0.2
175 0.25
176 0.33
177 0.37
178 0.45
179 0.5
180 0.5
181 0.49
182 0.5
183 0.46
184 0.44
185 0.41
186 0.34
187 0.33
188 0.35
189 0.35
190 0.38