Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015KPH4

Protein Details
Accession A0A015KPH4    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
15-40PYVQKIRFENKIKKRNPQKICSDCKEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 12.5, mito 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MSSKNYGQKTCGTPPYVQKIRFENKIKKRNPQKICSDCKETSDSIKLFSSKVNKLEEIVDNFYMNPIKKNKNKQISIFNAKFTLNNIPCELEYDLSKFSLENLHKLVNFTTQNCNNNNKYSSSIEKIDDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.59
3 0.6
4 0.56
5 0.53
6 0.55
7 0.58
8 0.63
9 0.64
10 0.64
11 0.67
12 0.75
13 0.76
14 0.78
15 0.82
16 0.83
17 0.83
18 0.81
19 0.81
20 0.8
21 0.83
22 0.79
23 0.76
24 0.66
25 0.61
26 0.56
27 0.46
28 0.41
29 0.38
30 0.32
31 0.26
32 0.27
33 0.25
34 0.21
35 0.24
36 0.26
37 0.23
38 0.27
39 0.27
40 0.25
41 0.26
42 0.28
43 0.27
44 0.24
45 0.23
46 0.19
47 0.17
48 0.16
49 0.16
50 0.16
51 0.13
52 0.14
53 0.17
54 0.24
55 0.31
56 0.41
57 0.49
58 0.56
59 0.6
60 0.61
61 0.65
62 0.65
63 0.68
64 0.6
65 0.52
66 0.44
67 0.4
68 0.36
69 0.29
70 0.31
71 0.23
72 0.23
73 0.23
74 0.23
75 0.22
76 0.25
77 0.24
78 0.15
79 0.14
80 0.14
81 0.14
82 0.13
83 0.13
84 0.1
85 0.1
86 0.17
87 0.17
88 0.19
89 0.21
90 0.24
91 0.25
92 0.26
93 0.27
94 0.26
95 0.28
96 0.27
97 0.34
98 0.37
99 0.42
100 0.45
101 0.52
102 0.49
103 0.52
104 0.52
105 0.45
106 0.43
107 0.43
108 0.45
109 0.43
110 0.42