Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015KCT9

Protein Details
Accession A0A015KCT9    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MARGNQREKAREKNLKKQSKQPKKKEDGNAFKKRABasic
NLS Segment(s)
PositionSequence
7-34REKAREKNLKKQSKQPKKKEDGNAFKKR
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007513  SERF-like_N  
Pfam View protein in Pfam  
PF04419  4F5  
Amino Acid Sequences MARGNQREKAREKNLKKQSKQPKKKEDGNAFKKRAESDAEIMRQKQQKALELKALESKAEKETNQSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.81
4 0.81
5 0.82
6 0.83
7 0.86
8 0.86
9 0.86
10 0.84
11 0.88
12 0.88
13 0.87
14 0.86
15 0.86
16 0.85
17 0.77
18 0.7
19 0.63
20 0.53
21 0.44
22 0.37
23 0.29
24 0.23
25 0.26
26 0.29
27 0.29
28 0.29
29 0.33
30 0.34
31 0.32
32 0.33
33 0.3
34 0.33
35 0.37
36 0.39
37 0.4
38 0.36
39 0.38
40 0.39
41 0.37
42 0.31
43 0.28
44 0.27
45 0.26
46 0.29
47 0.27