Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015KXS7

Protein Details
Accession A0A015KXS7   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-41RLDSGGKRIRKKPVKPCQDCKETNHydrophilic
NLS Segment(s)
PositionSequence
24-29KRIRKK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MSSKNKKYDQRTYMQKIRLDSGGKRIRKKPVKPCQDCKETNDCIKLFSNKINRLEEIVGNFRKNIPRKTNEISLFRAKFTLNSVPCELEYDLSRFTLESLQKLADFTTQNCNNKNDPSSSKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.71
3 0.63
4 0.59
5 0.55
6 0.49
7 0.42
8 0.44
9 0.46
10 0.49
11 0.54
12 0.57
13 0.62
14 0.68
15 0.75
16 0.75
17 0.77
18 0.82
19 0.84
20 0.87
21 0.85
22 0.85
23 0.78
24 0.73
25 0.71
26 0.64
27 0.6
28 0.55
29 0.46
30 0.4
31 0.4
32 0.37
33 0.31
34 0.32
35 0.36
36 0.36
37 0.41
38 0.4
39 0.38
40 0.36
41 0.36
42 0.3
43 0.24
44 0.25
45 0.22
46 0.2
47 0.2
48 0.19
49 0.24
50 0.28
51 0.32
52 0.34
53 0.36
54 0.41
55 0.46
56 0.52
57 0.51
58 0.49
59 0.47
60 0.48
61 0.45
62 0.39
63 0.36
64 0.28
65 0.24
66 0.24
67 0.28
68 0.21
69 0.24
70 0.25
71 0.25
72 0.25
73 0.27
74 0.24
75 0.17
76 0.17
77 0.16
78 0.15
79 0.14
80 0.14
81 0.11
82 0.12
83 0.16
84 0.16
85 0.16
86 0.17
87 0.18
88 0.18
89 0.19
90 0.18
91 0.17
92 0.17
93 0.18
94 0.26
95 0.33
96 0.38
97 0.42
98 0.46
99 0.45
100 0.49
101 0.51
102 0.48
103 0.48