Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A015JAG8

Protein Details
Accession A0A015JAG8   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGNIKSHLKHKRPSIKKIPEFDQIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041698  Methyltransf_25  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF13649  Methyltransf_25  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MGNIKSHLKHKRPSIKKIPEFDQIESDKERNEKLIDYYLSTSIDSIDRLHIYHFLRAYIFQSRFSSPVEDKLIEGGCKVLDVGCGAATWLLDLSNKYENSYFYGVDIKPIYPQEIKPNNLEFIEADVTNRLSFHDNEFDFTHLENMSFVFTPDQWDFILSELVRVTKPGGYIEISDRRNGYIGEGPIFRKLTDAIWSTYSKRNIDVKLVYKLDSKFELQPNIGKVHRIEKDLIIGPNGDKIGLVFQDLTFSYHKSELSIKVLSEEMGISEEEYKNMVENLVEEFKQTSTESVHVRFWTQKQLSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.86
4 0.86
5 0.81
6 0.79
7 0.74
8 0.66
9 0.63
10 0.53
11 0.49
12 0.46
13 0.42
14 0.36
15 0.35
16 0.34
17 0.29
18 0.29
19 0.27
20 0.26
21 0.32
22 0.29
23 0.29
24 0.3
25 0.28
26 0.27
27 0.25
28 0.21
29 0.16
30 0.15
31 0.13
32 0.12
33 0.13
34 0.13
35 0.13
36 0.14
37 0.19
38 0.2
39 0.24
40 0.23
41 0.21
42 0.21
43 0.22
44 0.24
45 0.27
46 0.26
47 0.25
48 0.27
49 0.28
50 0.29
51 0.29
52 0.32
53 0.24
54 0.29
55 0.3
56 0.27
57 0.26
58 0.28
59 0.28
60 0.22
61 0.21
62 0.15
63 0.11
64 0.1
65 0.1
66 0.07
67 0.06
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.06
74 0.05
75 0.05
76 0.04
77 0.04
78 0.05
79 0.06
80 0.09
81 0.14
82 0.14
83 0.15
84 0.17
85 0.17
86 0.2
87 0.22
88 0.19
89 0.14
90 0.2
91 0.18
92 0.2
93 0.2
94 0.16
95 0.17
96 0.18
97 0.2
98 0.17
99 0.18
100 0.26
101 0.31
102 0.33
103 0.34
104 0.36
105 0.34
106 0.32
107 0.31
108 0.2
109 0.16
110 0.16
111 0.12
112 0.11
113 0.1
114 0.1
115 0.1
116 0.1
117 0.08
118 0.09
119 0.1
120 0.12
121 0.17
122 0.16
123 0.19
124 0.19
125 0.19
126 0.17
127 0.17
128 0.16
129 0.1
130 0.1
131 0.08
132 0.07
133 0.07
134 0.07
135 0.07
136 0.06
137 0.06
138 0.09
139 0.09
140 0.1
141 0.09
142 0.09
143 0.09
144 0.09
145 0.12
146 0.08
147 0.09
148 0.08
149 0.09
150 0.08
151 0.08
152 0.09
153 0.07
154 0.08
155 0.08
156 0.09
157 0.09
158 0.1
159 0.14
160 0.21
161 0.21
162 0.21
163 0.21
164 0.2
165 0.21
166 0.19
167 0.17
168 0.14
169 0.14
170 0.15
171 0.17
172 0.17
173 0.2
174 0.2
175 0.18
176 0.14
177 0.14
178 0.13
179 0.16
180 0.17
181 0.15
182 0.18
183 0.2
184 0.22
185 0.28
186 0.31
187 0.27
188 0.3
189 0.34
190 0.32
191 0.36
192 0.38
193 0.36
194 0.39
195 0.39
196 0.36
197 0.35
198 0.35
199 0.32
200 0.29
201 0.28
202 0.27
203 0.3
204 0.32
205 0.28
206 0.31
207 0.31
208 0.33
209 0.31
210 0.27
211 0.24
212 0.29
213 0.31
214 0.3
215 0.3
216 0.26
217 0.31
218 0.33
219 0.32
220 0.24
221 0.22
222 0.2
223 0.21
224 0.2
225 0.15
226 0.1
227 0.1
228 0.11
229 0.1
230 0.11
231 0.09
232 0.08
233 0.11
234 0.12
235 0.14
236 0.13
237 0.14
238 0.16
239 0.17
240 0.17
241 0.17
242 0.21
243 0.22
244 0.26
245 0.26
246 0.23
247 0.23
248 0.24
249 0.22
250 0.18
251 0.14
252 0.1
253 0.09
254 0.09
255 0.08
256 0.12
257 0.12
258 0.12
259 0.13
260 0.13
261 0.13
262 0.13
263 0.13
264 0.08
265 0.09
266 0.14
267 0.17
268 0.16
269 0.16
270 0.17
271 0.17
272 0.19
273 0.19
274 0.16
275 0.15
276 0.2
277 0.24
278 0.26
279 0.3
280 0.29
281 0.32
282 0.37
283 0.38
284 0.44