Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015JRQ6

Protein Details
Accession A0A015JRQ6    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MTNKNKKVKKSKKSKKRHHSDSDSDRKSDBasic
38-58DPELRCTKRRRSELTKKQKPTBasic
NLS Segment(s)
PositionSequence
4-19KNKKVKKSKKSKKRHH
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MTNKNKKVKKSKKSKKRHHSDSDSDRKSDKQSSTKQGDPELRCTKRRRSELTKKQKPTLIDIVQDKGNSGCEIMKGKKPIFIDLVDEDDEGNDDMIQQNERNNDQLTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.95
3 0.95
4 0.95
5 0.94
6 0.92
7 0.91
8 0.91
9 0.9
10 0.83
11 0.74
12 0.65
13 0.57
14 0.52
15 0.49
16 0.45
17 0.42
18 0.47
19 0.54
20 0.58
21 0.59
22 0.56
23 0.55
24 0.57
25 0.5
26 0.52
27 0.52
28 0.5
29 0.53
30 0.56
31 0.59
32 0.6
33 0.64
34 0.64
35 0.64
36 0.71
37 0.76
38 0.82
39 0.83
40 0.78
41 0.75
42 0.7
43 0.61
44 0.55
45 0.52
46 0.43
47 0.37
48 0.35
49 0.33
50 0.31
51 0.29
52 0.24
53 0.16
54 0.15
55 0.11
56 0.1
57 0.08
58 0.09
59 0.14
60 0.17
61 0.21
62 0.26
63 0.26
64 0.3
65 0.3
66 0.31
67 0.3
68 0.27
69 0.26
70 0.22
71 0.25
72 0.22
73 0.21
74 0.17
75 0.15
76 0.15
77 0.11
78 0.1
79 0.06
80 0.06
81 0.08
82 0.1
83 0.12
84 0.12
85 0.16
86 0.21
87 0.23
88 0.26