Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3KBJ2

Protein Details
Accession J3KBJ2    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
178-197EAARNGKPRRNGEKAKPAKSBasic
NLS Segment(s)
PositionSequence
181-197RNGKPRRNGEKAKPAKS
Subcellular Location(s) nucl 18, cyto_nucl 14, cyto 6
Family & Domain DBs
KEGG cim:CIMG_03520  -  
Amino Acid Sequences MPHAEKDVMGEPVVNGDHPQSQFINHLASYPFVSGSLENIKANPYGQKSLELADQGYSQFAKPFLPYLAKPYGYVAPYVSKADELGNEGLNRMDSTIPAVIHASENIKETIRGYVSAPFRLAEDGKGYVLETYSSERNAVGDGSFSRSKAAVSTGLRLTADSCLWLRGYLIPEAKINEAARNGKPRRNGEKAKPAKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.11
4 0.17
5 0.17
6 0.2
7 0.18
8 0.19
9 0.21
10 0.22
11 0.23
12 0.17
13 0.19
14 0.16
15 0.17
16 0.17
17 0.15
18 0.14
19 0.11
20 0.12
21 0.1
22 0.12
23 0.16
24 0.16
25 0.16
26 0.16
27 0.18
28 0.17
29 0.18
30 0.2
31 0.19
32 0.21
33 0.22
34 0.24
35 0.23
36 0.24
37 0.25
38 0.2
39 0.17
40 0.14
41 0.14
42 0.11
43 0.12
44 0.11
45 0.09
46 0.1
47 0.1
48 0.09
49 0.09
50 0.11
51 0.11
52 0.14
53 0.14
54 0.19
55 0.23
56 0.23
57 0.22
58 0.23
59 0.25
60 0.21
61 0.22
62 0.17
63 0.14
64 0.15
65 0.16
66 0.14
67 0.1
68 0.1
69 0.1
70 0.1
71 0.1
72 0.1
73 0.1
74 0.1
75 0.1
76 0.1
77 0.09
78 0.09
79 0.07
80 0.06
81 0.05
82 0.06
83 0.08
84 0.07
85 0.07
86 0.08
87 0.07
88 0.07
89 0.08
90 0.08
91 0.07
92 0.08
93 0.09
94 0.09
95 0.09
96 0.09
97 0.11
98 0.1
99 0.1
100 0.1
101 0.15
102 0.17
103 0.17
104 0.17
105 0.15
106 0.15
107 0.16
108 0.16
109 0.11
110 0.11
111 0.11
112 0.1
113 0.1
114 0.1
115 0.08
116 0.08
117 0.08
118 0.07
119 0.09
120 0.1
121 0.11
122 0.11
123 0.11
124 0.11
125 0.11
126 0.1
127 0.07
128 0.07
129 0.08
130 0.13
131 0.14
132 0.14
133 0.15
134 0.14
135 0.14
136 0.14
137 0.15
138 0.16
139 0.17
140 0.21
141 0.21
142 0.22
143 0.22
144 0.21
145 0.2
146 0.16
147 0.14
148 0.12
149 0.12
150 0.12
151 0.12
152 0.12
153 0.12
154 0.14
155 0.16
156 0.19
157 0.21
158 0.21
159 0.23
160 0.25
161 0.26
162 0.28
163 0.26
164 0.25
165 0.28
166 0.32
167 0.35
168 0.44
169 0.48
170 0.48
171 0.56
172 0.62
173 0.66
174 0.71
175 0.74
176 0.74
177 0.8