Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015J4J7

Protein Details
Accession A0A015J4J7    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
402-421IGVFMFVRRRKRNANVIPTPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 19, E.R. 3, nucl 1, cyto 1, plas 1, cyto_nucl 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR015915  Kelch-typ_b-propeller  
Gene Ontology GO:0016020  C:membrane  
CDD cd12087  TM_EGFR-like  
Amino Acid Sequences MNKFTLFLITLSCLLQIVNSQLSPNLRKLFSAVFIEKKLYIYGGFMDKEDANAQKTPDDRFFYLDVSIPFDTSNLPWRAIPDNAKNLPLESLSSIFTGGLAASVGGVKNETIFFLNNEKDNTTSPVHSYNSLNNVWNTQNLSGVRPIGRNQMRAITDNNGKIYLLTGFDFTAQEVNRANGLFICDTINLNCVIKDAPLSRLGYGVTLLPNGNLVYMGGGDRNYVPISDGFKVIYLYDPINDKWDSKVTTGNIPPADVGITTVLGLSGDKIILFGGNNGDNNNLYVLDTTNYEWYVPEVRGKSPVFKRGEHCANVIGKYMVVTFGSNGVLQAKYRTVGESDVLLLDISSESEYIWTTSFDPSSLTNNSTSSVSLPSLPSKSKKYFIIKISFIVGLLVLIIISIGVFMFVRRRKRNANVIPTPGDDYALHHDKSKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.12
5 0.14
6 0.14
7 0.14
8 0.18
9 0.24
10 0.27
11 0.32
12 0.35
13 0.32
14 0.33
15 0.35
16 0.35
17 0.33
18 0.37
19 0.35
20 0.33
21 0.34
22 0.37
23 0.35
24 0.33
25 0.29
26 0.23
27 0.18
28 0.15
29 0.17
30 0.19
31 0.19
32 0.18
33 0.2
34 0.19
35 0.21
36 0.23
37 0.22
38 0.2
39 0.22
40 0.23
41 0.24
42 0.26
43 0.29
44 0.32
45 0.35
46 0.33
47 0.35
48 0.35
49 0.32
50 0.31
51 0.3
52 0.24
53 0.23
54 0.22
55 0.19
56 0.17
57 0.16
58 0.16
59 0.14
60 0.22
61 0.19
62 0.2
63 0.2
64 0.23
65 0.26
66 0.3
67 0.35
68 0.34
69 0.41
70 0.42
71 0.43
72 0.4
73 0.38
74 0.34
75 0.28
76 0.22
77 0.15
78 0.14
79 0.13
80 0.13
81 0.13
82 0.11
83 0.1
84 0.09
85 0.07
86 0.05
87 0.04
88 0.04
89 0.04
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.06
96 0.06
97 0.07
98 0.08
99 0.08
100 0.1
101 0.15
102 0.18
103 0.19
104 0.2
105 0.2
106 0.2
107 0.21
108 0.24
109 0.21
110 0.2
111 0.2
112 0.23
113 0.23
114 0.24
115 0.25
116 0.24
117 0.27
118 0.28
119 0.28
120 0.24
121 0.26
122 0.24
123 0.24
124 0.22
125 0.17
126 0.2
127 0.18
128 0.19
129 0.18
130 0.19
131 0.19
132 0.19
133 0.2
134 0.26
135 0.28
136 0.28
137 0.28
138 0.32
139 0.31
140 0.32
141 0.32
142 0.28
143 0.3
144 0.3
145 0.29
146 0.23
147 0.22
148 0.2
149 0.18
150 0.14
151 0.1
152 0.08
153 0.08
154 0.08
155 0.09
156 0.09
157 0.08
158 0.11
159 0.1
160 0.11
161 0.11
162 0.12
163 0.12
164 0.12
165 0.12
166 0.09
167 0.1
168 0.09
169 0.08
170 0.09
171 0.08
172 0.09
173 0.09
174 0.09
175 0.08
176 0.08
177 0.08
178 0.07
179 0.07
180 0.07
181 0.09
182 0.09
183 0.1
184 0.13
185 0.14
186 0.13
187 0.14
188 0.14
189 0.12
190 0.11
191 0.1
192 0.07
193 0.07
194 0.07
195 0.06
196 0.07
197 0.06
198 0.06
199 0.05
200 0.04
201 0.03
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.05
208 0.06
209 0.06
210 0.05
211 0.06
212 0.08
213 0.1
214 0.11
215 0.11
216 0.1
217 0.11
218 0.11
219 0.1
220 0.09
221 0.08
222 0.07
223 0.08
224 0.1
225 0.1
226 0.13
227 0.14
228 0.13
229 0.14
230 0.17
231 0.18
232 0.17
233 0.21
234 0.18
235 0.24
236 0.24
237 0.27
238 0.23
239 0.22
240 0.21
241 0.17
242 0.16
243 0.1
244 0.09
245 0.05
246 0.05
247 0.05
248 0.05
249 0.04
250 0.04
251 0.04
252 0.04
253 0.04
254 0.04
255 0.04
256 0.04
257 0.04
258 0.04
259 0.05
260 0.05
261 0.07
262 0.08
263 0.09
264 0.09
265 0.1
266 0.1
267 0.1
268 0.1
269 0.08
270 0.07
271 0.07
272 0.07
273 0.07
274 0.08
275 0.08
276 0.09
277 0.1
278 0.09
279 0.09
280 0.1
281 0.12
282 0.12
283 0.16
284 0.17
285 0.18
286 0.24
287 0.25
288 0.32
289 0.34
290 0.42
291 0.4
292 0.43
293 0.45
294 0.48
295 0.54
296 0.48
297 0.44
298 0.41
299 0.4
300 0.37
301 0.35
302 0.26
303 0.18
304 0.17
305 0.16
306 0.11
307 0.09
308 0.08
309 0.07
310 0.08
311 0.09
312 0.08
313 0.09
314 0.1
315 0.1
316 0.1
317 0.12
318 0.12
319 0.12
320 0.13
321 0.13
322 0.12
323 0.13
324 0.14
325 0.12
326 0.12
327 0.11
328 0.11
329 0.09
330 0.08
331 0.07
332 0.06
333 0.06
334 0.05
335 0.05
336 0.05
337 0.06
338 0.07
339 0.07
340 0.08
341 0.08
342 0.09
343 0.12
344 0.12
345 0.12
346 0.13
347 0.14
348 0.18
349 0.19
350 0.2
351 0.19
352 0.19
353 0.21
354 0.2
355 0.19
356 0.16
357 0.16
358 0.15
359 0.15
360 0.17
361 0.2
362 0.24
363 0.28
364 0.32
365 0.38
366 0.42
367 0.45
368 0.51
369 0.55
370 0.59
371 0.62
372 0.65
373 0.59
374 0.56
375 0.54
376 0.45
377 0.37
378 0.29
379 0.2
380 0.12
381 0.1
382 0.07
383 0.04
384 0.03
385 0.03
386 0.02
387 0.02
388 0.02
389 0.02
390 0.03
391 0.03
392 0.04
393 0.13
394 0.2
395 0.3
396 0.37
397 0.45
398 0.54
399 0.63
400 0.73
401 0.76
402 0.8
403 0.78
404 0.79
405 0.75
406 0.69
407 0.64
408 0.53
409 0.45
410 0.34
411 0.3
412 0.32
413 0.34
414 0.32