Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A015LW94

Protein Details
Accession A0A015LW94    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
113-134VWKNSKYNTTRKRNKCGKMGKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Pfam View protein in Pfam  
PF00505  HMG_box  
Amino Acid Sequences MSCQTTTSIISKESPLLSLPFPPTISASDIINKRKPCRFISKSPNAFLIYRKAFLDHLSLTNHNLRMTEVSKLVSNHWKNETEFVKDAYRKISQDVETELSEKRKDCVSYRVVWKNSKYNTTRKRNKCGKMGKAMKNKGNKFDAIQSITKFKPTANRGNIFYQFVPAFPNIEHNSKSSKKHEKEVISTSDHENVCNSPEISSQNSEYSENSEHSEHSEHSEHSEHSEHSEYLECSGFNEFNEYPNYQASNYDLDCNQLNQLYTNFNNCNDFNDQFSESLINEQQEQLIYQNIPKNNSIYEFGLDWYLQSFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.22
4 0.21
5 0.24
6 0.25
7 0.23
8 0.23
9 0.23
10 0.23
11 0.22
12 0.24
13 0.2
14 0.19
15 0.24
16 0.3
17 0.36
18 0.41
19 0.45
20 0.49
21 0.55
22 0.59
23 0.58
24 0.63
25 0.63
26 0.67
27 0.72
28 0.76
29 0.77
30 0.73
31 0.71
32 0.63
33 0.56
34 0.49
35 0.47
36 0.39
37 0.34
38 0.32
39 0.29
40 0.26
41 0.26
42 0.28
43 0.21
44 0.21
45 0.22
46 0.23
47 0.25
48 0.3
49 0.3
50 0.26
51 0.24
52 0.22
53 0.23
54 0.23
55 0.22
56 0.18
57 0.18
58 0.2
59 0.2
60 0.24
61 0.29
62 0.31
63 0.33
64 0.36
65 0.39
66 0.37
67 0.43
68 0.41
69 0.36
70 0.35
71 0.33
72 0.36
73 0.34
74 0.34
75 0.32
76 0.33
77 0.28
78 0.29
79 0.32
80 0.27
81 0.27
82 0.29
83 0.27
84 0.23
85 0.24
86 0.24
87 0.22
88 0.22
89 0.21
90 0.19
91 0.2
92 0.22
93 0.23
94 0.28
95 0.29
96 0.33
97 0.42
98 0.48
99 0.49
100 0.52
101 0.53
102 0.53
103 0.53
104 0.55
105 0.51
106 0.53
107 0.59
108 0.65
109 0.71
110 0.71
111 0.79
112 0.8
113 0.82
114 0.81
115 0.8
116 0.76
117 0.76
118 0.78
119 0.77
120 0.77
121 0.77
122 0.73
123 0.73
124 0.68
125 0.63
126 0.56
127 0.48
128 0.39
129 0.37
130 0.35
131 0.3
132 0.29
133 0.24
134 0.26
135 0.25
136 0.25
137 0.21
138 0.17
139 0.22
140 0.25
141 0.33
142 0.35
143 0.38
144 0.39
145 0.43
146 0.44
147 0.38
148 0.33
149 0.26
150 0.2
151 0.17
152 0.16
153 0.12
154 0.11
155 0.09
156 0.15
157 0.15
158 0.18
159 0.18
160 0.18
161 0.24
162 0.28
163 0.32
164 0.35
165 0.43
166 0.43
167 0.5
168 0.56
169 0.54
170 0.54
171 0.55
172 0.51
173 0.43
174 0.42
175 0.37
176 0.36
177 0.32
178 0.27
179 0.22
180 0.19
181 0.17
182 0.18
183 0.16
184 0.1
185 0.12
186 0.14
187 0.16
188 0.17
189 0.17
190 0.17
191 0.18
192 0.18
193 0.17
194 0.18
195 0.18
196 0.17
197 0.18
198 0.17
199 0.16
200 0.17
201 0.19
202 0.15
203 0.18
204 0.19
205 0.17
206 0.2
207 0.22
208 0.2
209 0.21
210 0.22
211 0.18
212 0.19
213 0.22
214 0.18
215 0.18
216 0.21
217 0.18
218 0.17
219 0.18
220 0.14
221 0.13
222 0.15
223 0.14
224 0.11
225 0.17
226 0.15
227 0.17
228 0.2
229 0.2
230 0.19
231 0.21
232 0.22
233 0.17
234 0.17
235 0.17
236 0.18
237 0.19
238 0.2
239 0.18
240 0.19
241 0.2
242 0.2
243 0.19
244 0.16
245 0.16
246 0.15
247 0.16
248 0.19
249 0.2
250 0.26
251 0.26
252 0.26
253 0.3
254 0.28
255 0.31
256 0.31
257 0.31
258 0.27
259 0.29
260 0.29
261 0.24
262 0.25
263 0.22
264 0.17
265 0.21
266 0.2
267 0.18
268 0.17
269 0.17
270 0.18
271 0.16
272 0.17
273 0.14
274 0.15
275 0.15
276 0.19
277 0.26
278 0.28
279 0.31
280 0.32
281 0.33
282 0.32
283 0.34
284 0.33
285 0.29
286 0.27
287 0.25
288 0.24
289 0.24
290 0.21
291 0.18